KEGG   Drosophila mojavensis: Dmoj_GI21462Help
Entry
Dmoj_GI21462      CDS       T01062                                 

Definition
GI21462 gene product from transcript GI21462-RA
Orthology
K15759  
inositol monophosphatase 3 [EC:3.1.3.25 3.1.3.7]
Organism
dmo  Drosophila mojavensis
Pathway
Inositol phosphate metabolism
Sulfur metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:dmo00562]
Metabolism; Energy metabolism; Sulfur metabolism [PATH:dmo00920]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:dmo04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 348 aa AA seqDB search
MYGRTIRINRVPAAITAILLTIVLVYFLNYHKDERPAIYGMLRSDNKVNLRKMLIAAIQA
AQRGGLEVLDVAHSRQLKERSKGQTAEGVNDPFTDADGRSHCVMKQGLQRLFPRVRIFSE
EDKEQCKDANSFDLDRTVLPETAIVPDVAVTAQDVTIWVDPLDATKEFTEELYEYVTTMV
CVAVAGRPVIGVIHNPFSGQTAWAWVGHSMSDYLDELRKLPRLKSDQPVITVSRSHAAAV
KDVARNVFGEQVSLLTAAGAGYKVLQVVANNATAYLHSSIIKKWDICAGEAILRALGGTM
TTLDDEPINYGPDDSPVNKGGLLASLEKHEEYMERISKYRSMHNGKLR
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtatggacgcacgatacgtataaatcgagttccagctgccataacggccatcctgttg
accattgtgctcgtctacttcctcaactaccacaaggatgagcgtcccgccatctatggc
atgctgcgcagcgacaacaaagtgaatctgcgcaaaatgcttatcgcggctatacaggcg
gcccagcgtggtgggctcgaggtgctggatgtggcgcattcgcggcagctcaaagagcgc
agtaaaggccaaacggccgagggcgttaatgatccatttacggatgcggatggccgttcg
cattgtgtgatgaagcagggcttgcaacgcctctttccacgtgttcgcatcttctccgag
gaggacaaggagcaatgcaaagatgcgaacagcttcgatttagatcgcacggtacttcca
gagactgccattgtgcccgatgtggcagtcacggcgcaggatgtaaccatttgggtagat
ccgctggatgccaccaaggagtttacagaggagctctacgagtacgtaacgaccatggtg
tgcgttgccgtcgccggtcgtccagtgattggtgtcatacataatcccttcagcggtcag
accgcctgggcgtgggttggccacagcatgtccgactatctggatgagctgcgcaagctg
ccacgactgaaatcggatcagcccgtcatcacggtttctcgctcccatgcagccgccgta
aaggatgtggcgcgcaatgttttcggcgagcaggttagcttgcttaccgctgctggtgct
ggctacaaggtgctccaagtggtggcaaacaatgctaccgcctatctgcatagctccatc
atcaagaagtgggacatttgtgccggcgaggccatactgcgagcccttggcggcaccatg
accaccctcgacgacgagccaatcaactacggccccgacgattcgccggttaataaaggc
ggcctattagccagcttggaaaagcatgaggagtacatggagcgcatctccaaataccgc
tctatgcacaatggcaaacttagataa

DBGET integrated database retrieval system