KEGG   Drosophila mojavensis: Dmoj_GI21462Help
Entry
Dmoj_GI21462      CDS       T01062                                 

Definition
GI21462 gene product from transcript GI21462-RA
Orthology
K15759  
inositol monophosphatase 3 [EC:3.1.3.25 3.1.3.7]
Organism
dmo  Drosophila mojavensis
Pathway
Inositol phosphate metabolism
Sulfur metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Dmoj_GI21462
  Energy metabolism
   00920 Sulfur metabolism
    Dmoj_GI21462
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    Dmoj_GI21462
Enzymes [BR:dmo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Dmoj_GI21462
    3.1.3.25  inositol-phosphate phosphatase
     Dmoj_GI21462
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 348 aa AA seqDB search
MYGRTIRINRVPAAITAILLTIVLVYFLNYHKDERPAIYGMLRSDNKVNLRKMLIAAIQA
AQRGGLEVLDVAHSRQLKERSKGQTAEGVNDPFTDADGRSHCVMKQGLQRLFPRVRIFSE
EDKEQCKDANSFDLDRTVLPETAIVPDVAVTAQDVTIWVDPLDATKEFTEELYEYVTTMV
CVAVAGRPVIGVIHNPFSGQTAWAWVGHSMSDYLDELRKLPRLKSDQPVITVSRSHAAAV
KDVARNVFGEQVSLLTAAGAGYKVLQVVANNATAYLHSSIIKKWDICAGEAILRALGGTM
TTLDDEPINYGPDDSPVNKGGLLASLEKHEEYMERISKYRSMHNGKLR
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtatggacgcacgatacgtataaatcgagttccagctgccataacggccatcctgttg
accattgtgctcgtctacttcctcaactaccacaaggatgagcgtcccgccatctatggc
atgctgcgcagcgacaacaaagtgaatctgcgcaaaatgcttatcgcggctatacaggcg
gcccagcgtggtgggctcgaggtgctggatgtggcgcattcgcggcagctcaaagagcgc
agtaaaggccaaacggccgagggcgttaatgatccatttacggatgcggatggccgttcg
cattgtgtgatgaagcagggcttgcaacgcctctttccacgtgttcgcatcttctccgag
gaggacaaggagcaatgcaaagatgcgaacagcttcgatttagatcgcacggtacttcca
gagactgccattgtgcccgatgtggcagtcacggcgcaggatgtaaccatttgggtagat
ccgctggatgccaccaaggagtttacagaggagctctacgagtacgtaacgaccatggtg
tgcgttgccgtcgccggtcgtccagtgattggtgtcatacataatcccttcagcggtcag
accgcctgggcgtgggttggccacagcatgtccgactatctggatgagctgcgcaagctg
ccacgactgaaatcggatcagcccgtcatcacggtttctcgctcccatgcagccgccgta
aaggatgtggcgcgcaatgttttcggcgagcaggttagcttgcttaccgctgctggtgct
ggctacaaggtgctccaagtggtggcaaacaatgctaccgcctatctgcatagctccatc
atcaagaagtgggacatttgtgccggcgaggccatactgcgagcccttggcggcaccatg
accaccctcgacgacgagccaatcaactacggccccgacgattcgccggttaataaaggc
ggcctattagccagcttggaaaagcatgaggagtacatggagcgcatctccaaataccgc
tctatgcacaatggcaaacttagataa

DBGET integrated database retrieval system