KEGG   Drosophila mojavensis: Dmoj_GI21482Help
Entry
Dmoj_GI21482      CDS       T01062                                 

Definition
GI21482 gene product from transcript GI21482-RA
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
dmo  Drosophila mojavensis
Pathway
FoxO signaling pathway
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:dmo04068]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1159 aa AA seqDB search
MDIETDQSIEAMDTQDTQEVEIITSDLQQQQQQQQQQQQQQQQTNSPPQLPKFKNLIHPQ
QQQQQQQQQQQQQQQQQQQQPQLPSENGNVPPQQLLAESSSTSFGNEQEMPMDDETKEDQ
FRSETTFSYTVENVAQLKQQHLSPPVYVRMLPWKIMVIPNERALGFFLQCNGENDSPTWS
CNAIAELRLKCHKPDAPPFTRARIKHLFYSKENDYGYSNFITWQELQDPDKYYVHNGSIT
LEVHVIADAPHGVLWDSKKHTGYVGLKNQGATCYMNSLLQTLYFTNSLRLAVYRIPTEAD
DSTKSVGLSLQRVFHELQFGDRPVGTKKLTKSFGWETLDSFMQHDVQEFLRVLLDKLESK
MKGTCLEGTIPGLFEGKMSSYIKCTNVDYNSTRYETFYDIQLNIKDKKNIFESFQDYVAS
ETLEGDNKYDAGVHGLQEASKGVIFTSFPPVLHLHLMRFQYDPITDSSIKYNDRFEFYEQ
INLDRYLADRENTPADYVLHAVLVHSGDNHGGHYVVFINPKADGRWFKFDDDVVSSCRKQ
EAIDQNYGGMDDEISFHAKCSNAYMLVYIRHSELDRVLGDIPENEISSDLVERLDLEKRI
EMARRKERSEANLYVPIHVILEEYFESQQKRRLFDLEKTHQRPFKLKQTQTVNEMVEMLV
KAFGVPRDRMRMWNMCTAQTQKFLYFDFEAEATRTIEQIPTSQKPWVIFLELAPPDSSEP
LRPFNPKTDVLLFLKYYDARNKRLNYIGCTQQPLTRRLSELVPEVNRKLGFDLDTELTVF
DEYADKKIANINEPIENVLYMPQDHLQGPILIFERENVDVKLDLPTVEDYFLDLVYRIEI
IFSDKCNPNEPDFTLELSNRYNYDQLTNAVAERLNTDPQKLQFFMCISNYKETAGNXXXX
XXXXXGYNGSGTIKDLLSYTKQSTPKRIFYQRLSLSIHELDNKKLFKCIWVSNDLKEEKE
LVLYPNKNDTVKGLLDEAAKTITFAENSRKKLRLMKVGNHKIVAICKDDIPLETLMKTNE
SITTTQGTQKVYRIEEVPADEAQLAENELLVPVAHFSKELYNSFGVPFLTKARHGEPYGA
LKQRIQKRLNVPDKEWENYKFAVITMGHTIDVNDNTPVDLEVYRTWTGGQLPFFGLDHIN
KSRKRSSLNFSEKAIKIYN
NT seq 3480 nt NT seq  +upstreamnt  +downstreamnt
atggacattgaaacagatcagtctatcgaagcaatggatacccaggatacccaagaggtc
gagataatcacaagcgacctacagcagcagcagcaacaacaacaacagcagcagcagcaa
caacagcaaacaaactcgccgccacaattgccaaagtttaaaaatctaattcatccgcag
cagcagcagcaacagcagcagcagcagcaacaacagcaacaacaacagcagcagcagcag
ccgcagctacccagtgagaacggcaacgtgccgccacagcaattgctagctgagagcagc
tccacatcatttggcaacgaacaagagatgccaatggacgacgaaaccaaggaggatcaa
ttccgatcggagacaacgttttcctataccgtggagaatgtggcgcagcttaagcagcag
catctatcgccgcccgtctatgtgcgcatgctgccatggaagatcatggtcataccgaat
gagcgtgcgctcggcttctttttgcagtgtaacggggagaacgattcgccgacctggtcg
tgcaatgcgattgccgagctgcgtctgaagtgccacaagccggatgcgccgccatttacg
cgcgctcgcatcaagcatttgttctactcgaaggagaatgactatggctattcgaatttc
atcacctggcaggagttgcaggatccagataaatactatgtccacaatggcagcatcacg
ctcgaggtgcacgtcattgccgatgcaccgcacggtgtcctctgggactcgaagaagcac
accggctatgtgggcctgaagaatcagggcgccacttgctatatgaactcgttgctccag
acgctatatttcacaaattcactacgcttggccgtctatcgcatcccgaccgaggccgat
gatagcaccaagtcggtaggcttgtcgctgcagcgcgtcttccacgagttgcagttcggc
gatcgtccggtcggcaccaagaagctaaccaaatcctttggctgggaaactctcgactcg
ttcatgcagcacgatgtccaggagtttctgcgcgtgctcctcgacaagctcgagtcgaag
atgaagggcacctgcctggagggcaccattcccggcctcttcgagggcaaaatgtcatcg
tacatcaaatgcacaaatgtcgattacaacagcacacgctacgagaccttctacgatatt
cagctaaatatcaaagacaagaagaacatcttcgaatcatttcaggactatgtcgcctcc
gagacacttgagggcgataacaaatacgatgccggtgtccatggtctccaggaggcgagc
aagggcgtcatattcacatcattcccgcctgtgctgcatttgcatttgatgcgtttccaa
tatgatccaattaccgatagctcgatcaaatataacgatcgatttgagttctatgaacag
atcaatttggatcggtatctggccgaccgtgagaatacgccggccgattatgtgctgcac
gctgtcctcgtccattccggcgacaatcacggcgggcattatgtggtcttcatcaatccc
aaggccgacggacgttggttcaagtttgatgacgatgtcgtctccagttgccgcaagcaa
gaggccatcgatcagaactatggcggcatggatgatgagatctcgtttcatgccaagtgc
agtaatgcatacatgctggtctacatacgtcactcggagctggaccgtgtgctgggcgat
atacccgagaatgagatctctagcgatctggtggagcgactcgatttggagaaacgcatc
gagatggcgcgacgcaaggagcgcagcgaggccaatctctatgtgcccattcacgttata
ctcgaggagtactttgagtctcagcagaagcgccgactgttcgatctggagaagacgcac
cagcgtcccttcaagctaaagcaaacccaaaccgttaacgagatggtcgagatgctggtg
aaggcattcggtgtgccgcgcgatcgcatgcgcatgtggaacatgtgcacggcccagaca
caaaagttcctgtactttgatttcgaggcggaggcgacacgcaccatcgaacagataccc
acatcgcagaagccgtgggtcatattccttgagttggcaccgcccgacagcagcgagccg
ctgcggccgttcaatcccaaaacggatgtgcttctattcctcaagtattacgatgcgcgg
aacaagcgcctcaattacatcggctgcactcagcagccgttaacgcgccgtctcagcgaa
ctggtgccggaggtcaatcggaagctcggcttcgatctggacaccgagctgaccgtgttc
gatgagtatgccgataagaagatcgctaacataaacgagcccatcgagaatgtgctctat
atgccgcaggatcatctccagggtcccattttgatattcgaacgggagaatgtggatgtt
aagctcgatttgcccaccgttgaggattacttcttggatctggtctatcgcatcgagatc
atattcagcgacaagtgcaaccccaatgagccggactttacgctcgaactgtcgaatcgc
tacaattacgatcaactgaccaatgccgtcgccgagcgcctcaacaccgatccccagaag
ctgcagttcttcatgtgcatcagcaactacaaggagaccgccggcaatgnnnnnnnnnnn
nnnnnnnnnnnnnnngggtataatggttctggtaccatcaaggatctgctgtcgtacacg
aagcagagcacgccaaagcggattttctatcagagactgtccctgagcatacacgaattg
gataacaaaaagttattcaagtgcatttgggtatccaatgacctgaaagaggagaaggag
ctggtgctgtatccgaataagaatgatacggtgaaggggctgctcgatgaggcggccaag
acgatcacgttcgccgagaatagccgcaagaagctgcgcctgatgaaggtcggcaatcat
aagattgtggccatctgcaaggacgacataccgctggagacgctgatgaagaccaatgag
tcgataaccaccacacagggcactcagaaggtctaccgcatcgaggaggtgccggccgat
gaggcacagctggccgagaacgagctcctcgtaccggtggcccatttcagcaaggagctg
tacaattcatttggtgtgccgttcctaaccaaggcgcgccatggcgagccatatggtgca
ctcaagcagcgcatccagaagcgactcaatgtaccggacaaggagtgggagaactacaag
ttcgccgttatcacaatgggccataccatcgatgtgaacgataatacccccgttgatctg
gaggtctatcgcacctggactggcggacagttgccgttcttcggactggatcacatcaac
aaatcgcgcaagcgcagctcgctcaatttctccgagaaggcaatcaaaatctacaactaa

DBGET integrated database retrieval system