KEGG   Drosophila mojavensis: Dmoj_GI21561Help
Entry
Dmoj_GI21561      CDS       T01062                                 

Definition
GI21561 gene product from transcript GI21561-RA
Orthology
K11851  
ubiquitin carboxyl-terminal hydrolase 30 [EC:3.1.2.15]
Organism
dmo  Drosophila mojavensis
Brite
Enzymes [BR:dmo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Dmoj_GI21561
Peptidases [BR:dmo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dmoj_GI21561
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 545 aa AA seqDB search
MESEKILMAAGVTVAAVVGAFVFWGPSALAACPQFIAWLQLYNGASPDRKSLISSMLSTL
EVVNGTHATLRGDPHSPGAVLRALNTLGWVIPQEEHDAHELFHVLLSSLEEEATRPQQVG
CLSDALLPASASNQMNVGNDTGDGLDMGTGAATAAAAAYRTCNMAGQRIGDQPNRPSSAM
LTDFLNMEYDEATSLQRLVRSEAHTPDSPASVCERETSEIMTPATAGAGGASTFLPFGYG
LDFETQAEPLNVSPMLGNERLSRPRLPQQQQLQQQQQHQGEGLNRRVSSSCRSLERLNRG
PGRVSIWSSMMPSQVAHPFQGAMGAQIVCNGCGSKSAVRYDKFDSITLNLPSQRRTGLSL
GHLLSEYITSEDLSDVKCDSCNETTMHTKSVTFAKLPACLCIHIARTVWLPTGQVCKRQD
YVHFPESLSMAPYSFVQPHLNSQAGTPWGSTMSLYSSSLPMNNGGGAGGEGFGAMFPKNL
YRLLAVVVHSGEANSGHFVTYRRGSLRNAHRWFYTSDTIVREVSIDEVLSVPAYLLFYDR
GQQRR
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atggaaagtgagaagattttgatggccgccggtgtcacggtggccgccgttgtgggcgcc
ttcgttttttggggcccatcggctctggctgcctgtccacagttcattgcctggctgcag
ttgtacaatggtgcctcgcctgatcgcaagagtttgatcagctccatgctgagcaccctg
gaggtggtgaatggcacgcacgccacactgcgtggtgatccccattcaccaggcgcagtg
ctgcgcgccctaaatacccttggctgggtaataccgcaggaggagcatgatgcacatgag
ttgttccatgtgctgctctcatcactggaggaggaggccacacggccgcagcaggtgggc
tgcttgtccgatgccctgctgccggccagtgcgagcaatcaaatgaacgttggtaacgac
actggcgacggcttggatatgggcacaggagctgctacagccgcagcagctgcctatcgc
acttgcaacatggctggccaacgcattggcgatcagcccaatcgaccttccagtgccatg
ctaaccgatttccttaatatggagtatgatgaagcgaccagcctacaacgtctggtccgc
tccgaggctcacacaccagattcaccagcctcggtgtgtgaacgtgaaacttctgagatt
atgacgccagcaacggctggtgctggcggcgcctccacctttctgccattcggctatggc
ttggattttgagacgcaggcggagccattaaacgtttcgccaatgctgggcaacgagcgt
ctctcacgtcctcgcctacctcaacagcagcagctgcagcagcaacagcagcaccaaggt
gagggcctcaatcgacgcgtctcgagctcctgccgttcgctggagcgtctgaaccgcggt
cctggccgtgtgtcgatttggtcgagcatgatgcccagccaggtggcgcatccgtttcaa
ggcgctatgggcgcccaaatcgtttgcaatggctgcggctccaagtccgctgtgcgctat
gataaattcgatagcatcaccctaaatctgccctcacagcggcgcactggcctgagcttg
ggccacttactcagcgagtacattacctccgaggatttgagcgatgtcaaatgcgactca
tgcaatgagacaacaatgcacaccaaatctgtgacctttgccaagctcccagcttgcctg
tgcatccacattgcgcgcaccgtttggctgcccaccgggcaggtgtgcaagcgacaggat
tacgtgcattttcccgagagcttgtccatggcgccatatagctttgtgcagcctcatcta
aacagtcaggcgggcacaccttggggctcgaccatgtcgctgtattcctccagcttgccc
atgaacaatggcggcggtgctggcggcgaaggcttcggtgccatgttcccaaagaatctg
tatcggctgctcgctgtggtcgtacattccggcgaggcgaatagcggacactttgtgacc
tatcgacgcggttccttacgcaatgcacatcgctggttctatacatcggataccattgta
cgtgaggtatcaattgatgaggtactcagtgtgccggcatatttattgttctacgatcgt
ggtcagcagcggcgctga

DBGET integrated database retrieval system