KEGG   Drosophila mojavensis: Dmoj_GI21654Help
Entry
Dmoj_GI21654      CDS       T01062                                 

Definition
GI21654 gene product from transcript GI21654-RA
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
dmo  Drosophila mojavensis
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dmoj_GI21654
Enzymes [BR:dmo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Dmoj_GI21654
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1488 aa AA seqDB search
MDVLELLRASVNGCYNTLFSDAWSQYVSKQIATTTYWYGALLAIGALFIAWFLYFKRLAS
LRLRDESARTLSALTAASGGDHRGLRFRKRDKMLFYGRRMLRKMKNVSGQMYSSGKGYKR
RAVMRFARRILQLQRENRPLEMKTVEPPAEYLEETIDGSDRVPPDALYMLQSIRIFGHFE
KPIFLKLCKHTQLLQLMAGDYLFKITDPDDSVYIVQSGMINVYICNADGSTLSLKTVRKG
ESVTSLLSFIDVLSGNSSYYKTVTAKAMEKSVVIRLPMQAFEEVFNENPDVMIRVIQVIM
IRLQRVLFTALRNYLGLNAELVQNHMRIKGSNPVPVTVPGPVLSQASQASRAMASRPATS
PVTRMSREEHTLSDPDPNPNASAMLFAEVHGDAPYIDLYHHQQQQSSGVSVGGTHRSSGA
CTPTGSGGESPDGTGNATITNIDQRLVQSSAVDSLRRELGLSEEDTSIIEPFVEVRELEP
NVTLITEGNAEDVCIWFVMTGTLAVYQSNADATRAAKQDSKNDMLIHFVHPGEIVGGLAM
LTGEASAYTIRARSNSRIAYIRRAAIYQIMRQRPRIVLDLGNGVVRRLSPLVRQCDYALD
WIFLESGRAVYRQDESSDSTYIVLSGRMRSVITHPGGKKEIVGEYGKGDLVGIVEMITET
SRTTTVLAVRDSELAKLPEGLFNAIKLRYPIVVTRLISFLSHRFLGSMQTRGANASSAPV
EANPVTHKYSTVALVPITDDVPITPFTYELYHSLCAIGPVLRLTSEVVRKQLGNNIFEAA
NEYRLTSWLAQQEDRNIITLYQCDSALSPWTQRCMRQADVVLIVGLGERSHMVGKFEREI
DKLAMRTQKELVLLYPETTNARPANTLSWLNARPWVTKHHHVLCVKRIFTRKSQYRINDL
YSRVLLSEPNMHSDFSRLARWLTGNSIGLVLGGGGARGAAHIGMLKAIQEAGIPIDMVGG
VSIGALMGALWCSERNITTVTQKAREWSKKMTKWFLQLLDLTYPITSMFSGREFNKTIHD
TFGDVSIEDLWIPYFTLTTDITASCHRIHTNGSLWRYVRSSMSLSGYMPPLCDPQDGHLL
LDGGYVNNLPGHLWRYCRASMSIAGVFPPFCDYRDGHLLLDGCYTNNVPADVMHNLGAAH
IIAIDVGSQDDTDLTNYGDDLSGWWLLYKKWNPFTSPVKVPDLPDIQSRLAYVSCVRQLE
EVKNSDYCEYIRPPIDKYKTLAFGSFDEIRDVGYVFGKNYFDNMAKAGRLGRFNQWFNKE
PPKRGNHASLNEYTFIDLAQIVCKLPETYALNAVDIFSEDEDFDGYISEPTTLNMDRHRI
QVPRAGNSLSFSETELDSDVEIDLELERKVDKSTQSTPPTPNKKHPSTPTSSQGNLMHLP
LSMKAKDKMQILDKLEREHKRRQKSKHKRDRSMQRDSKATLHPAPMAEATTQTPSSDVDI
DAKLDQLRKLQQELEQGNESEQEQEQEQEQEQGHIQEPENVTEADTKN
NT seq 4467 nt NT seq  +upstreamnt  +downstreamnt
atggatgtcctggaattgcttcgtgcgagcgttaacggctgttacaacacattattctca
gatgcttggtcgcaatatgtctccaaacaaatcgccacaacgacgtactggtatggcgcg
ttgctggctatcggagcgctgtttatcgcctggtttctgtatttcaagcgcttggcatcg
ttgcgcctgcgcgatgaaagcgcccgtacactgagcgctctcaccgccgcctcgggcggc
gatcatcgcggcttgcgatttcgcaaacgcgacaaaatgctcttctatggccgccgcatg
ttgcgcaaaatgaagaacgtcagcggccagatgtacagcagcggcaagggctacaaacgg
cgtgcggtgatgcgcttcgctcgccgcatcctgcagctgcagcgcgagaatcgtccgctc
gagatgaagacagtggagccgccggcggaatatctggaggagactatcgatggcagcgat
cgtgtgccaccagatgctctctatatgctccaaagtattcgcatctttgggcatttcgag
aagccgatcttcttgaagctctgcaagcacacccagctgctgcagcttatggccggtgac
tatctgttcaagataaccgatccggatgacagcgtctacatcgtccagtcgggaatgatc
aatgtctacatctgcaatgccgatggcagcacactctcgctgaagacggtgcgcaagggt
gaatccgtgacatcgttgctcagcttcatcgatgtactgtctggcaattccagctactac
aagacagttacggctaaggccatggagaagtcggttgtcattcggctgcccatgcaggca
ttcgaggaggtgtttaacgaaaatccggatgtgatgatacgtgtgatacaggtgataatg
atacggctgcagcgtgtgctcttcacagcattgcgcaattacttaggcctcaatgcggag
ctcgtgcagaaccatatgcgtatcaagggcagcaatccagtgcccgttacggtgcctggg
ccggtgctctctcaggcctcacaggcatcgcgtgcaatggcctcacggccagctacatcg
ccggtcacacgtatgtcgcgcgaggagcacacactctccgacccggatcccaatccgaat
gccagtgccatgctcttcgccgaggtgcacggcgatgcgccctacattgatctgtaccat
caccaacagcaacagtcgagcggtgtctcggttggtggaactcatcgcagctcgggtgcc
tgtacacccactggcagcggcggggaatcacccgatggcacgggcaatgccaccatcacc
aacatcgatcagcgtctggtgcaatcatcggccgtcgacagtttgcgccgtgagctcggc
ctgagtgaagaggatacgagcattattgagccatttgttgaggtccgcgaattggagccg
aacgtgacgctaatcaccgagggcaatgccgaagatgtgtgcatttggtttgtgatgacc
ggcaccctggccgtctaccagagcaacgcggatgctacgcgcgccgccaagcaggacagc
aaaaacgacatgctcatccatttcgtgcatcccggcgaaattgttggcggcctggccatg
ctcaccggtgaggcgagtgcctataccatcagggctcgcagcaatagccgtattgcctat
atacgccgtgctgctatctatcaaataatgcgccagcgtccacgcattgtcctcgatttg
ggcaatggagttgtgcgccgtttgtcgccgttggtgcgtcagtgtgattacgctctggat
tggatatttctggagtcgggtcgtgccgtctatcggcaggacgagagcagcgatagcaca
tatattgtgctaagcggacgcatgcgttcggtcatcacgcatccgggcggcaagaaggag
atcgtcggcgaatacggcaagggtgatctggtgggcattgtcgagatgataaccgaaacg
tcgcgcaccaccacagtgctggctgtgcgcgactcggagctggccaaattgcccgagggc
ttgttcaatgccatcaaattgcgatatccgattgtggtaacacggctaattagtttcctt
agccatcgcttcttgggctcgatgcagacacgcggcgccaatgcatccagtgcgcccgtt
gaggccaatcccgtaacgcacaaatattcaacagtggccctcgttcccatcaccgacgat
gtgccgatcacacccttcacctatgagctatatcattcactctgtgccattggtcctgtg
ctccgtctcacatcggaggtggtgcgcaagcagctgggcaacaatatatttgaggcggcc
aacgaataccgtctgacctcgtggcttgcacagcaggaggatcgcaacataatcacgctc
tatcaatgcgacagtgcgctgagtccctggacacagcggtgcatgcgtcaggcagatgtg
gtgctaattgtcggcctgggcgaacgctcccatatggttggcaaattcgagcgggagatc
gataagctagcgatgcgcacacaaaaagagctcgtcctgctctatccggagacaacgaac
gcccggccagcgaacacgctcagctggctcaatgcacgtccctgggtgaccaagcatcat
catgtgctctgtgtgaaacgcatcttcacacgcaagagccagtatcgcattaatgatctg
tatagccgcgtgctgctctccgagccgaatatgcattccgatttctctcgtctggctcgg
tggttgactggcaattcgattggcttggtcctgggtgggggcggtgctcgtggtgctgcc
cacattggcatgctgaaagccatacaggaggcgggtatacccattgatatggttgggggc
gtcagcattggcgcgctgatgggcgccctctggtgttcggagcgcaatataactaccgtt
acacagaaggcgcgcgaatggtcaaagaaaatgacaaaatggttccttcaactgctagac
ctcacataccctataacatcgatgttctcgggccgtgaattcaacaagaccatacacgat
acctttggcgatgtgagcattgaggatctgtggataccctactttacgctcaccactgac
ataactgccagttgccatcgcattcacaccaacggatctctgtggcgttatgtgcgctcc
tcaatgtcactcagcggctatatgccgcccctatgcgatccacaagatggacatcttctg
ctggatggcggctatgtaaataatttgccaggtcatctgtggcgctattgccgtgccagt
atgtccattgccggcgtctttccgcctttctgtgattatcgtgacgggcacctgctgctc
gacggatgctatacgaacaatgtgccagccgatgttatgcacaatctgggcgccgcgcac
atcattgccatcgatgtgggctcacaggacgacacggatttaaccaactatggtgacgat
ctgagtggctggtggctgctctataagaagtggaatccatttacatcgccggtcaaagtg
cccgatctgccggatatacaatcacgcttagcttacgtgtcctgcgtgcggcagctagag
gaagtgaaaaactcggactattgcgagtatatacgtccgcccattgataaatataagaca
ctcgcctttggcagcttcgatgagatacgcgacgtgggctacgtctttggcaaaaattat
tttgataatatggctaaagcgggccgcttgggccgcttcaatcaatggttcaacaaggag
ccgccaaagcgtggcaaccacgcctcgctcaacgaatacacattcattgatctggcgcag
atcgtctgcaagctgccagagacgtatgccttaaatgcggttgatatatttagcgaggat
gaggatttcgatggctatatctcggagccaacgactctcaatatggatcgtcatcgcatt
caggtgccacgtgctggcaactcgttatccttctcagagactgaactggactcggatgtg
gagatcgatctggagctggagcgcaaggtggataagtcgacgcaatcgacaccgccgacg
ccaaacaagaagcatccatcgacaccgacatccagtcaagggaatctaatgcatttgcca
ttgagtatgaaggcaaaggataaaatgcaaattctcgataaattggaaagggagcacaag
cgtcgccagaagtcgaagcacaagcgtgacaggtcgatgcagcgcgacagcaaagccaca
ttgcatccggctccgatggccgaggcgacaactcaaacgccttctagcgatgtggacata
gacgcgaaactggatcagctgcgaaaattgcagcaggagctggagcaggggaatgagtca
gaacaggaacaggaacaggagcaggagcaggagcagggccatattcaggagccggagaat
gttacagaagccgataccaaaaactag

DBGET integrated database retrieval system