KEGG   Drosophila mojavensis: Dmoj_GI21703Help
Entry
Dmoj_GI21703      CDS       T01062                                 

Definition
GI21703 gene product from transcript GI21703-RA
Orthology
K13278  
60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
dmo  Drosophila mojavensis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 648 aa AA seqDB search
MCSNGDETDGHLQVRAPAIDIKQKPSETVLPSPTMQPLAMRRNVSGDSLLIPSASKEAHV
RVIYTGGTIGMMRNERNVLAPIPNALVRLIRKYPNIHDEDYAQRHFGAGASMGPLVLPYV
QGEARRIVYQVTEYSPLLDSSNMTMDDWARIAKDIHQSYEFFDGFVVLHGTDTLSYTASA
LSFMLENLGKTVIITGSQLPIFETRTDGKDNFTSALIIAGNYVIPEVCIFFGNKLMRGNR
TVKVSSNSLDAFDSPNVPPLAQIGINVNVDYRLIFRPCTVERFCVHSQLDENVGLLRIFP
SISLATFRAFLAPPMRGVVMQSFGSGNVPSNRKDLIDELKAAAARGVIIINCTQCPNGSV
AEIYDTGKVLFDVGVIPGYDMTPEAALTKLAYVIGKSEWSLEVKKQMMQSNLRGELTSMG
AHAMKDYDLVDAVARSLHLSSPQELNQLGNTLFPAMINAAVMEGNIKKLTNLKAYGANLS
GTNHDQRTALHLACQLGNVAIVRFLLQNGVSVHKRDLCERTALQEAIATDNAEIIQLLIS
CGAHLTGSSRAVGEQLCAAAARGALRRLQSYQLAGADLSLPDPSGRTALHVAALHGNVNV
VKYLLENTERAELKDMIGLTPLDYATRGGHSEVVRLLTPNETEPEPDT
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgtgctccaacggcgatgaaaccgacggccacctacaggtccgagcgccagcaatcgat
ataaaacaaaagcccagcgagacggtgctcccatcacccacaatgcagccgctggcaatg
cgtcgcaacgtgagcggcgacagtctcctgattccgtccgcctcgaaggaggcacacgtt
cgcgtcatctatacgggcggcaccatcggaatgatgcgcaacgaacggaatgtcttggcg
cccattccgaacgctttggttcgtcttatccgcaaatatccgaatattcacgatgaggat
tatgcgcagcgacactttggcgctggcgcctccatggggccgctggtgctgccctacgtt
cagggcgaggcgaggagaatcgtctaccaggtgacggaatattcgccgctgctcgactcc
agcaatatgaccatggatgactgggcgcgcattgccaaggatattcaccaatcgtacgag
ttcttcgacggcttcgtggtgctccatggcacagacacgctctcgtacacggcctcggct
ctgtcgttcatgctggagaacctgggcaagacggtgatcataacgggcagccagctgccg
atcttcgagactcgaacggatggcaaggataacttcacctcggcgctgatcattgccggc
aactatgtgataccggaggtgtgcatcttctttgggaacaagctgatgcgcggcaaccgc
actgtgaaggttagctccaactcgctggatgcgttcgattcacccaatgtgccgccgttg
gcgcagatcggcatcaatgtgaacgtggactatcgcctgatcttccggccgtgcaccgtg
gagcgtttctgcgtgcactcgcagctggacgagaatgtcggcttgttgcgcatctttccc
agcatttcgctggccacgtttcgcgccttcttggcgccgccgatgcgcggcgtggtgatg
cagtcctttggctctggcaatgtaccatcgaatcgcaaggatctgatcgacgaactgaaa
gcggccgccgctcgtggcgtcatcatcatcaactgcacccagtgcccgaatggctcggtg
gccgagatctatgacaccggcaaggtgctgttcgatgtgggcgtcatacccggatacgat
atgacaccggaggcggcgctcaccaagctggcctacgtgataggcaaatccgagtggtcg
ctcgaggtgaagaagcagatgatgcagtcgaatctgcgcggcgagctgacttccatgggc
gcgcatgcaatgaaggactacgacctggtcgatgcagtggctcgttcgctgcatctgtcg
tcgccgcaggagctcaatcaactgggcaacacgctcttcccggccatgatcaatgcggcc
gtcatggagggcaacatcaagaagctgacgaatctgaaagcctatggcgcaaatctctct
ggcaccaatcatgaccagcgcacggcgctccatctcgcctgccagctgggcaacgtggcc
attgtgcggttcctgctgcagaacggcgtctcggtgcacaagcgggatctgtgcgagcgc
acggccttgcaggaggccatcgcgacggacaatgcagagatcattcagttgctcatcagt
tgtggcgcccacttgactggatcctcgcgtgccgtgggcgaacagctgtgcgccgctgca
gctcgtggtgcactgcgtcgcctgcaatcctatcagctggccggtgccgatttaagtttg
ccggatccctcgggacgcacagcattgcatgtggctgcgctccatggcaatgtgaatgtg
gtgaagtaccttctggaaaatacggagagagcagagttgaaggatatgattgggctgaca
ccgttggactatgccacacgtggcggccattccgaggttgtgcgtcttctaacgcccaac
gagacggagccggagccggatacttaa

DBGET integrated database retrieval system