KEGG   Drosophila mojavensis: Dmoj_GI21725Help
Entry
Dmoj_GI21725      CDS       T01062                                 

Definition
(RefSeq) GI21725 gene product from transcript GI21725-RB
  KO
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.4.19.12]
Organism
dmo  Drosophila mojavensis
Brite
Enzymes [BR:dmo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dmoj_GI21725
Peptidases [BR:dmo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dmoj_GI21725
Ubiquitin system [BR:dmo04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    Dmoj_GI21725
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 1174 aa AA seqDB search
MENRVCFGAGLKVNKSDIKNNNKQAKENQSNNINGDNISNNNNQCKRDNETLDALGTRNN
KMRARGSRQPLGQLKNVNGNTCSGSMVKKRQSDAQQDGGSWSDSGEEEMVNGHAAAGSNA
PSCQHIKKAVDPTRLRRHLKSTGLLYDCQMCQKLNPPSESGNESAACEYDNTLWLCLKCG
TQLCSRERNKHALLHYQTPHSDSHALALNTRSFKIWCYDCGSEVCANSRKNLLDCVELVK
RLAQKPLATVADVQYKIISTLDQISPIVPMTGGKQMSATTVGNTAIPMPPPTPPSPPPSA
SSTGSVPGMAKRVLDKRVICQTATGVPSTSSVGNPELDRLPRVRGLTNLGNTCFFNAVMQ
CLAQTPFLLDVLKELAEPGEQFVLPGGTFNFKDKGDVELPMIRGTLCSWGNLTSALANAL
EELQSGGGVFTPSKLFDKLCAKCPQFTGGDQHDAHELLRQLLESVRSEDLKRYQRVILQN
LGYKDQDISSVSEELRQKCKIYGNQAADRILRPDQVFRGFLVSTLTCQDCFNISSRHEYF
LDISLPVAVEKPQPPQRRRTSPESSPSSTNQSNSVNPKLSNGESEVGVPSPPFYLHTDGP
ETLGPSKAQVKKEKERERKAKRAAKHQRTKQAQRLSLKLNNSDESNGGGGGGDDVDGEQQ
PGSGDSQGQAQPTSADTDSEKTRSAPWGEGPRTKSASQSATTSEQSDADVEDNLVDDAAA
GRNAKFYTDSNGNSQPVGEKRDDTPEHMDKDSLEEDENDSGIATSPAPTTATNSAASTTS
TASNGTSSNNNNNEANSRTDANAPADGAAASLVNASLSEKGASLIRQFSSGQLQLKMEQL
KLREQAKNAAPSKRVRTQSYSDWSTTIAPRYQCEVGECSVASCLNNFTAVELMTGQNKVG
CESCTRRINGSDPQAKTVNTNATKQLLVSSPPAVLILHLKRFQLGPRCIFRKLTRPVSYT
VLLDIAAFCGSKVKNLPNIDRKQKKLLYALYGVVEHSGGLYGGHYTAYVKVRPKVTPDDK
RWKFLPHGSKAELDQDDEQLKKLEELLAKEKAREMRMNALDDSDDFTSSSSNASTTDDST
SDLSNGAVDESVAGADAGADADAAAAAGAAPAPAAGVDGSSDQPASMASGEEEAANVKAP
PGKWYYVSDSRVQEVSEDAALKAQAYLLFYERIY
NT seq 3525 nt NT seq  +upstreamnt  +downstreamnt
atggagaaccgcgtatgttttggtgccggtttaaaagtaaacaagagcgacattaaaaac
aataacaaacaagcaaaggaaaaccagagcaacaacatcaacggcgataatatttctaat
aacaacaaccaatgcaagcgggacaacgaaacacttgatgcacttggcacgaggaataat
aagatgcgcgcgagggggtccagacagccgctgggtcagttgaagaacgtcaacggcaac
acctgcagcggcagcatggttaagaagcgtcagagcgacgcacagcaggacggcggcagc
tggtcagactcgggcgaggaggagatggtgaatggccatgccgctgccggaagcaatgcc
ccgagttgccagcacatcaagaaggcggtagatccgacacgtttgcggcgtcatctcaaa
tcgactggattgctctacgattgccagatgtgtcagaaactgaatccgcccagtgagagt
ggcaatgaatcagctgcatgtgaatacgacaacacactctggctgtgcctcaagtgcggc
acacagctgtgcagccgcgagcgcaacaagcacgcattactccactaccagactccgcat
tcggactcgcacgctctggcgttgaacacgcgctcattcaagatctggtgctacgactgc
ggcagtgaggtgtgcgccaactcgcgcaagaacttgctcgattgtgtggaactagtgaag
cgcctggcccagaagccgctcgccaccgtcgccgacgtgcagtacaaaataatatcaacg
ctggaccaaatcagtcccattgtgccgatgactgggggcaaacagatgagcgcgaccact
gtgggcaatacggccataccgatgccgccccctacgcctccatcgccaccgccgtcagcc
agctcgacgggctcagtgcccggcatggccaagcgtgtgctggacaagcgtgtcatctgt
cagacggcgactggcgtgccgtccacttcatctgtgggcaacccggagctggatcgattg
ccacgcgtgcgtggtctgaccaatttgggtaatacgtgcttcttcaatgcggttatgcag
tgtctggctcagacgccattcttactggacgtactcaaggaactggctgagcccggagag
caatttgtgctgcccggcggcacgtttaactttaaggacaagggcgacgttgagctgccc
atgataaggggcacactctgctcgtggggcaatctcacctccgccctggccaatgcactg
gaggaactgcagtccggtggcggcgtctttacgcccagcaaactctttgacaaactgtgc
gccaaatgcccccagtttactggaggagatcagcacgatgcgcacgagctgctgcgccag
ttgctggagagcgtgcgctctgaggacttgaagcgctatcagcgcgtcatattgcagaac
ttggggtacaaggatcaggatattagcagcgtgtcggaggagctgcgccagaagtgcaag
atctatggcaatcaggcagccgatcgcatactgcgcccggaccaggtgtttcgcggcttt
ctcgtctcgacactgacgtgtcaggattgctttaacatctcctcgcgacacgagtacttc
ttggatatatcactgcccgtcgcagtggagaagccgcagccgcctcagcgtcgcagaact
agtcccgagagctcgccctcgtccactaaccagagcaacagtgtcaacccgaagctcagc
aacggcgagtcggaagtgggcgtgccgtcgcctccgttttatctgcacactgatggcccg
gaaacgctggggccatccaaagctcaggtgaagaaggagaaggagcgcgaacgcaaggcc
aagcgcgccgccaagcaccagcgcaccaagcaggcccaacggctctcgcttaagctgaac
aacagcgatgagtcaaacggcggcggcggcggcggagatgacgtcgatggcgagcagcag
cccggcagtggcgatagccaggggcaggcgcagcccacttccgccgacacggatagtgag
aagacacgctcggcgccctggggcgagggtcctcgtaccaaatcggcttcccagagcgca
acaacatcggagcaatctgacgccgacgttgaggacaatctggttgatgacgcagccgcc
ggccgcaatgccaagttctacacagacagcaacggcaactcgcagccggtgggcgagaag
cgcgacgatacgcccgagcacatggacaaggattcgctggaggaggacgagaatgactca
ggcatagccaccagtccggcacccaccacagcaaccaacagcgcggccagcaccaccagc
accgccagcaatggcaccagcagcaacaataacaacaatgaagccaacagccggaccgat
gcgaacgccccagctgacggcgcggcagccagcctggtgaacgccagcttgagcgagaag
ggcgcctctctaatacgtcaattctcatcggggcagctgcagctgaagatggagcagctg
aagctgcgggagcaggccaagaatgcggcgccctcgaagcgtgtgcgcacccaaagctat
tcggactggagcactacgattgcgccgcgctatcagtgcgaggtgggtgagtgctcggtg
gcgtcgtgtctcaacaatttcaccgccgtggagctgatgacgggccagaacaaagtcggc
tgcgagagctgcacccgccgcatcaacggatccgatccccaagccaaaactgtaaataca
aatgcgaccaagcagctgctggtgtccagtccgccggctgtgctgatcttgcatctgaag
agattccagttggggccgcgttgcattttccgcaagctgacgcgcccggtcagctacact
gtcctgctggatatagccgccttctgcggctccaaagtgaagaacttgcccaacatcgat
cgcaagcagaagaagctgctctatgcgctctacggcgtcgtggagcactctggcggctta
tatggcggacactacaccgcctatgtgaaggtgcgcccgaaggtgactcccgatgataag
cgctggaaattcttgccgcacggcagcaaagctgagctggatcaagacgatgagcagcta
aagaagctcgaggagctgctagccaaggagaaggcccgtgagatgcgtatgaatgccttg
gatgatagcgatgatttcaccagctcaagcagcaatgcatccaccacagatgattccacc
tctgacctaagcaatggcgctgtcgatgagtctgttgctggtgctgatgctggtgccgac
gccgacgccgctgctgctgctggtgccgctcctgctcctgctgcgggcgttgacggctca
tccgatcagccggcgagcatggccagcggcgaggaggaagcggccaatgtgaaggcaccg
cccggcaaatggtattacgtatcggactcgcgcgtccaggaagtcagcgaggatgcggcc
ctcaaggcacaggcgtatctgctgttctatgagcgtatctattag

DBGET integrated database retrieval system