KEGG   Drosophila mojavensis: Dmoj_GI21811Help
Entry
Dmoj_GI21811      CDS       T01062                                 

Definition
GI21811 gene product from transcript GI21811-RA
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
dmo  Drosophila mojavensis
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    Dmoj_GI21811
Enzymes [BR:dmo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dmoj_GI21811
Transcription machinery [BR:dmo03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     Dmoj_GI21811
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 403 aa AA seqDB search
MWNSSSKTTTSNANNKENDLPIEAVYRAINAIKESKAAIKPTLLNPLSVPQDEIVKAEEQ
KGIIEFHCISNSLTKDVDKQTAIFLIALQSVFGQQLPEMPPTYITRLLYDPMHKTIVLAK
KGQAIGGICFRMFPTQGFTEIVFCAISMPEQVKGYGSYLMNHLKDYIMQKGIQHLLAYAD
CNAIGYFKKQGFSNNIRLARPIYEGYIKEYDSATLMHCELHPGIVNTQITSTIRQQKEVL
NELIAQRQKEVERVRTGLTCFKHGVAAIPIASIPGLKEIGWHPNFSATRVEERSNPAHLT
GLFEAVLQAMRRQTTAWPFLSPVNPKDVPDYYVHIKYPMDLKTVGERLERGYYKTRRLFM
ADMARMFSNCRSFNAPNTDYYRCATTLERFYLNKMRQFGLLDK
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgtggaatagtagtagtaaaacgactacaagcaatgctaataataaggaaaatgatctg
ccgatcgaagcggtctatcgtgccattaatgctataaaggagtcgaaggctgcaatcaag
cctacattactgaatccgttaagtgtaccccaagatgagatcgtgaaagccgaggagcag
aagggcatcattgagttccattgcattagcaactctttgacaaaggacgttgataagcag
actgcgatctttctgattgctctccaatcggtattcgggcaacagctgccggagatgcca
cccacttatataacccgactgctgtacgatcccatgcacaagacgatcgtgttggctaag
aagggtcaggctattggtgggatctgttttcgtatgtttcccacccaaggcttcaccgag
attgtgttctgtgcgatctccatgccggagcaggtgaagggctatggcagctatttgatg
aatcacttgaaggactacatcatgcagaagggcattcagcatctgctggcctatgccgac
tgcaatgccattggctatttcaagaagcagggcttctcgaacaatatacgtctagcacgg
cccatctacgagggctatatcaaggagtacgatagtgccactctaatgcactgcgagctc
catccgggcattgtgaacacccaaatcacatcgaccatacgccagcaaaaagaagtcctt
aatgaattgattgcacagcgccagaaggaggtggagagggtgcgaaccggccttacgtgc
ttcaagcatggggtcgccgctataccgatcgcttcgataccgggcctcaaagagatcggc
tggcacccgaatttttcggccactcgtgtcgaggaacgatcaaatcctgcccatctaacg
ggcctattcgaggcagtgctgcaggcgatgcgacgccaaaccactgcctggcccttccta
tcgcccgtcaatcccaaagacgtgcccgactattatgtccatatcaaatatccaatggac
ctgaagactgtgggtgagcgcctcgagcgtggctactataaaacgcgtcgcctgttcatg
gccgacatggcgcgtatgttttccaattgccgcagcttcaacgcacccaataccgattac
tatcgctgtgccacgactctcgagcgtttctacctgaacaagatgcgtcaattcggactc
ctagacaagtga

DBGET integrated database retrieval system