KEGG   Drosophila mojavensis: Dmoj_GI21992Help
Entry
Dmoj_GI21992      CDS       T01062                                 

Definition
GI21992 gene product from transcript GI21992-RA
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.1.2.15]
Organism
dmo  Drosophila mojavensis
Brite
Enzymes [BR:dmo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Dmoj_GI21992
Peptidases [BR:dmo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dmoj_GI21992
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 361 aa AA seqDB search
MGANVSQLEREIGSELFPPNEHYFGLVNFGNTCYSNSVLQALYFCKPFREKVLEYKAKNK
RPKETLLSCLADLFYSIATQKKKVGSIAPKKFITRLRKEKEEFDNYMQQDAHEFLNFLIN
HINEIILAERNSGKTPAAGSSATTTPIGQTNGANTEPTWVHEIFQGILTSETRCLNCETV
SSKDENFFDLQVDVDQNTSITHCLRCFSNTETLCSDNKFKCDNCCSYQEAQKRMRVKKLP
MILALHLKRFKYMEQFNRHIKVSHRVVFPLELRLFNTSDDAVNPDRLYDLTAVVIHCGSG
PNRGHYISIVKSHGLWLLFDDDMVDKIEASTIEDFYGLTSDIHKSSETGYILFYQSRDCA
A
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgggcgccaacgtatcgcagctggagcgggagatcggctccgaactgttcccgcccaac
gagcactatttcgggctggttaacttcgggaacacatgctatagcaactcggtgctgcag
gcgctctacttctgcaagccgtttcgcgagaaggtgctcgagtacaaggccaagaacaag
aggcccaaggaaacgctgctctcctgcctggcggacctcttctatagcattgccacgcag
aagaagaaggtcggctcgatagcgccgaagaagttcatcacgcggctgcgcaaggagaag
gaggagttcgacaactatatgcagcaggatgcccatgagtttctcaactttctgatcaat
cacatcaatgaaataatcctggccgaacgcaacagtggcaagacaccggctgccgggtcg
tcggcgaccacaactccaatcggtcagacgaatggagccaacacggagcccacctgggtg
cacgagatctttcaggggatcctcacgtcggagacgcgctgtctgaactgcgagaccgtg
agcagcaaggacgagaacttcttcgatctgcaggtggacgtggaccagaacacgtcgatc
acgcattgcttgcgctgcttcagcaacacggaaaccctttgctcggacaacaagttcaag
tgcgacaactgctgtagctaccaggaggcgcagaagcgaatgcgcgtcaagaagctgccc
atgatactggccctgcacctgaagcgcttcaagtacatggagcaattcaatcggcatatc
aaggtgtcgcatcgggtggtctttccgcttgagttgcggctgttcaacacctcggacgac
gctgtcaatccggataggctctacgatctgaccgcagtcgtcatacactgcggctcgggc
ccgaatcgtggccattacataagcattgtcaagagtcacgggctttggctgctcttcgat
gacgacatggttgacaaaatcgaggcttcgaccattgaggacttctacggcctcacctcg
gacatacacaagtcctccgaaacgggctatatattgttctatcagtcgcgcgactgcgct
gcttag

DBGET integrated database retrieval system