KEGG   Drosophila mojavensis: Dmoj_GI22044Help
Entry
Dmoj_GI22044      CDS       T01062                                 

Definition
GI22044 gene product from transcript GI22044-RA
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
dmo  Drosophila mojavensis
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Dmoj_GI22044
Enzymes [BR:dmo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Dmoj_GI22044
Transfer RNA biogenesis [BR:dmo03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Dmoj_GI22044
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 308 aa AA seqDB search
MTTNAPLIMRIMALSINTAKRAGVIIRDVLKQGDLGIVDKGKNDPQTEADRSAQRCIIAS
LAKKFPSIKIIGEEGGSDLNVCDEWLVGELDETFLKQDCPADWRDAKPEDFVIWVDPLDG
TAEYTQGFVEHVTVLIGIAIKNSAVGGIIHQPFYQQSSGELGRTIWGLKGLGTGGFTAVK
PPANEFIITTTRSHSNALHQKAVDVFNASKVLKVGGAGFKVLQLLEGKAHAYVFATPGCK
KWDTCAPEAVLEASGGTLTNINGEHYEYHENVEHVNGRGVLASVGNNHQELVEKIPLEVR
QAVGTKQT
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgaacgcaccacttattatgcgaataatggcattgtccattaacacggccaaa
cgggctggcgtcatcatacgcgatgttctcaagcagggcgacctcggcatcgtggataag
ggcaaaaatgatccacagacagaagccgaccgttcggcgcaacggtgcattattgcatct
ttggcaaagaaatttcccagcattaagataatcggtgaggaaggtggatccgatttgaat
gtatgcgatgaatggttggtgggcgaactggatgaaacattcctcaagcaagactgccca
gcggattggagggatgcaaaaccggaggactttgtcatatgggttgatcccttagatggc
actgcagaatatacacaaggatttgtggagcatgtgacggtgctcattggcatagccata
aagaactcagctgtgggtggcattattcaccagccattttatcaacaatccagcggcgag
ctgggacgcaccatttggggtctcaaaggcttgggcactggcggatttacggctgtcaaa
ccgccagccaatgaattcattatcacaaccacccgctcgcactcgaatgcactgcatcaa
aaggcagtggatgtgttcaatgccagcaaagtgctcaaggtaggcggcgctggattcaag
gtgttgcaactgctcgagggcaaggcacacgcttatgtctttgccacgcccggttgcaag
aaatgggacacttgtgcaccagaagctgtgctggaggccagtggtggaactctaaccaac
atcaatggcgaacactacgaataccatgagaatgtggagcatgtcaatggacggggagtg
ctcgccagtgttggcaacaatcaccaagagctggtggagaagatcccgctagaagtgcga
caggccgtaggcactaaacaaacgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system