KEGG   Drosophila mojavensis: Dmoj_GI22150Help
Entry
Dmoj_GI22150      CDS       T01062                                 

Definition
GI22150 gene product from transcript GI22150-RA
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
dmo  Drosophila mojavensis
Brite
Enzymes [BR:dmo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dmoj_GI22150
Transfer RNA biogenesis [BR:dmo03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Dmoj_GI22150
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 563 aa AA seqDB search
MRPKKKLAVGLSREERQVLVIGEIIQELLKAHESKKDVNLNRMKSLISSKYGLDSSPRLV
DIIAAVPHDAKKILLPKLRAKPIRTASGIAVVAVMCKPHRCPHINFTGNICVYCPGGPDS
DFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHRVEQLKQLGHSVDKVEFIVMGGTFMALS
EEYRDYFIRNLHDALSGHSSANVAEAVRYSEKSRTKCIGITIETRPDYCLKRHITDMLNY
GCTRLEIGVQSVYEDVARDTNRGHTVAAVCETFKMGKDAGYKIVTHMMPDLPNVDFERDI
EQFIEYFENPAFRSDGLKIYPTLVIRGTGLYELWKTGRYKSYPPSMLVDLVAKILALVPP
WTRVYRVQRDIPMPLVSSGVEHGNLRELALARMKDLGTVCRDVRTREVGIQEIHNKVRPY
EIELIRRDYVANGGWETFLSYEDPEQDILVGLLRLRKCSSETFRPELQGNCSIVRELHVY
GSVVPVSSRDPTKFQHQGFGTLLMEEAQRIAVEEHESTKIAVISGVGTRNYYRKLGYTLE
GPYMVKDLTQYRKEFEALNSTGW
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgagaccaaaaaagaaactagctgtgggtcttagccgcgaagagcgacaggtgcttgtc
atcggcgaaatcatacaggaactgcttaaggcacacgaaagcaaaaaggatgtgaatctg
aatcgcatgaagtcgctgatatcatccaaatatggactagacagctcaccacgtttggta
gacattatagcagcagtaccgcacgatgcaaagaaaatacttctgcccaaattgcgcgcc
aagccaatacgaactgcaagcggaattgccgtggttgctgtcatgtgcaagccacatcgt
tgtccgcacatcaatttcacgggcaacatttgcgtctattgccccggcggaccggacagc
gatttcgaatactccacacagtcgtatacgggctacgagcccacgtcgatgcgtgctata
cgcgcacggtacgatccttttctacagacccgtcatcgtgttgagcagctgaaacagcta
ggccattcggttgacaaggtggagtttattgttatgggaggtactttcatggccctgtcg
gaggaatatcgtgattattttatacgtaatttgcacgatgccctctccggtcacagcagc
gcaaatgtagctgaagctgtgcggtattccgagaaatcaagaaccaaatgcattggcatc
acaatcgaaacacgaccggattattgcctcaagcgtcacatcacggatatgctaaattat
ggctgcacacgtctggagatcggtgtgcagtcagtctatgaggatgtggccagagacacg
aatcgtggccatacggtggccgcggtatgtgaaacctttaagatgggcaaagatgccggc
tacaagattgtcacacacatgatgcccgatctgccaaatgttgactttgagcgtgacatc
gaacagtttattgaatactttgaaaatccagcttttcgctcagatggcctgaagatctat
cccactctggtcatacgcggcactggcctctatgagctttggaagacgggtcgctacaag
tcatatccaccgtccatgctggttgacttggtggccaaaattttggcattggtgccgccc
tggacgcgtgtctatcgagtacagcgtgatatacccatgcctttggttagctctggcgtt
gagcatggtaacctgcgtgaactggcgctggctcgcatgaaagatttgggaactgtttgt
cgggatgtgcgtacccgtgaggttggcattcaagagatccacaacaaagtgcgtccatac
gaaattgaattgatacgtcgggattacgttgcgaacggcggctgggagacgttcttatcg
tacgaggaccccgagcaggatatacttgtgggtctgctgcgccttcgcaaatgctcttcg
gagactttcagaccagaactgcagggcaattgctccattgtgcgcgagctgcatgtttat
ggctcggtggtgcccgtcagctctcgagatccaaccaagttccagcatcagggctttggc
actctgctcatggaagaggcgcagcgcatcgctgtcgaggagcatgaaagcactaagatt
gctgttatctcaggtgttggaactcgcaactattaccgaaaactcggctatacattggag
ggcccctacatggtgaaggatctgacacaatatcgaaaagaatttgaagcgctaaattcg
acgggttggtag

DBGET integrated database retrieval system