KEGG   Drosophila mojavensis: Dmoj_GI22170Help
Entry
Dmoj_GI22170      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
dmo  Drosophila mojavensis
Pathway
dmo00562  Inositol phosphate metabolism
dmo04068  FoxO signaling pathway
dmo04070  Phosphatidylinositol signaling system
dmo04140  Autophagy - animal
dmo04150  mTOR signaling pathway
dmo04213  Longevity regulating pathway - multiple species
dmo04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Dmoj_GI22170
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    Dmoj_GI22170
   04070 Phosphatidylinositol signaling system
    Dmoj_GI22170
   04150 mTOR signaling pathway
    Dmoj_GI22170
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    Dmoj_GI22170
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    Dmoj_GI22170
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    Dmoj_GI22170
Enzymes [BR:dmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     Dmoj_GI22170
Membrane trafficking [BR:dmo04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    Dmoj_GI22170
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_rbd PI3K_C2 PI3K_p85B DUF4135 ubiquitin
Motif
Other DBs
NCBI-GeneID: 6575060
NCBI-ProteinID: XP_002001080
FlyBase: FBgn0144899
UniProt: B4K8F9
Position
Unknown
AA seq 1076 aa AA seqDB search
MGDTLYISNETYMFSRFSIDLWKYDPPDTVHLTCLVFNGSTIYLHVKSTATIREVKEEIL
AQARYLPLSYMIKDACDYQICGISSYTIEPYTDETKRLFEVQPYFGLLSLRERSDSTTFS
SDYELTKMVTDIIGTSFDHQNTQGSPEVDYFRAKVTEVSDEIKLERSRYTWQQRLLYEHP
LRLANSTAMPELIRQRHPSSAFLIAVKNENDQSTFTLSVLEHDTPLSLIESTLQKMNRSQ
MKMNDRASDYILKVSGRDEYLFGDHPLIQFLYIQETLSDAAVPNVVLQSVLRLECYINHY
NEKSLGQKKPPNPNNQIAQIPLEPCNVIWNLENVNFSLTLHGVTNVNFDRARAFKVGVHV
GLYHGKRKLCSQRTVDAPSQGNSQDFQLDENVMTFDIQMRNLPRMTRLCIVVFEVTKMSR
SKKSSNNTSTLKDDFYNNNPLAWVNTTIFDYKDQLRKGRQTLYTWTYADDIQSDDVFYPL
GTVESNPRIDGCAMVHLTFHQGTNENCNDEAICYPSEDEVLQYAAERAYSNRDKQSLNME
ELGALLANYSGKDKIYEMVDQDRNTIWEHKNDILREFPEDLSVLLQCVYWKDRDDVSDIW
YLLKMWPLISIERSLELLDYAYPDPAVRGFAIKCLHNLKDEELLLYLLQLVQAIKHESYL
ANDLVIFLLQRALRNQRIGHYFFWHLRSEMHTPCMQTRFGLLLEAYLKGCNQHVKPLRKQ
LEVLEKLKVGSVLAKKGSKERVRTELQKFLRNEHNNGIFQNIQNPLNPSFRCRRVTPDKC
KVMDSKMRPLWVVFENVDQTANDVYIIFKNGDDLRQDMLTLQMLRVMDQLWKREGLDLRM
NIYNCISMEQRLGMIEVVRHSETIANIQKLKGMFSATSPFKKGSLYSWLKEHNKAPEKLN
KAINEFTLSCAGYCVATYVLGVADRHSDNIMVKRNGQLFHIDFGHILGHFKEKFGVRRER
VPFVLTHDFVYVINKGCIDREAKEFCYFQELCERAFLILRKHGCLILSLFSMMISTGLPE
LSSEKDLNYLRETLVLDYTEENARKHFQAKFSEALANSWKTSLNWASHNFSKNNKQ
NT seq 3231 nt NT seq  +upstreamnt  +downstreamnt
atgggcgatacactgtatatctccaacgagacatacatgttcagcagattctcaattgat
ctctggaagtatgatccaccggatactgtccatttaacatgcctggttttcaacggttcg
acgatctatttgcacgttaagtccacggcgaccattcgagaggtaaaagaggaaatattg
gcacaggctagatatctaccattgagctatatgattaaggatgcctgcgattatcaaata
tgtggcatctcgtcctatacgatcgagccatatacggacgaaacgaagcgtctgttcgag
gtccagccgtactttggcttgcttagccttagggaacgcagcgactcgaccaccttttct
agcgactatgagctaaccaaaatggttaccgacataattggtacatcgttcgatcatcaa
aacactcaaggttctcctgaggtagattattttcgcgctaaggtgacagaagtctccgat
gaaattaaattggagcgatcgagatatacgtggcagcagcgattgctctacgagcatccg
ctgcggcttgccaactcgacagccatgccagaactaatacgacaacgtcatccaagctcg
gcatttttgattgccgtcaagaacgagaatgatcaaagcacattcacgctgtccgtactg
gagcatgatacgccactctcattgatcgaaagcacgcttcagaagatgaaccgctcacag
atgaagatgaacgatcgcgcctccgactatatactcaaagtgagcggccgtgatgagtat
ctgtttggtgatcatccgctgatacaattcctgtacatacaagaaacgctctccgatgca
gccgtgccaaatgtggtgctgcagtcggtactgcggctcgagtgctacatcaatcactac
aatgagaaaagtctggggcaaaagaagcccccaaatccaaataatcaaatcgcacaaatc
ccattagagccctgtaatgtgatatggaatttggaaaatgtgaatttctcattaacattg
catggcgtcactaatgtcaacttcgatcgtgctcgagcctttaaagttggcgtccatgtt
ggcctctatcatggaaagcgaaaattgtgctcgcagcgcaccgtcgatgcgcctagccaa
ggcaattcgcaggactttcaattggatgaaaacgttatgacatttgatattcaaatgcgc
aatctgccacgaatgacgcgtctgtgtattgtggtattcgaagtgaccaaaatgtcgcgc
tcgaagaaatcgtctaataataccagcacgctcaaggatgacttctacaacaacaatcca
ttggcctgggtcaatacaacgatctttgactataaagatcagttgcgtaagggacgtcaa
acactatacacctggacctatgcagacgacatccagtcggatgatgtgttttatccgctg
ggcactgtcgagtccaatccacgcatagacggttgtgctatggtgcatctgacattccac
caaggcaccaatgaaaattgcaacgacgaagctatctgttatcctagcgaggatgaagtt
ctacaatatgcagcagaacgagcgtactccaatcgtgataagcaatcgctaaatatggag
gagcttggtgccctattggcgaattattcgggcaaagacaaaatttacgaaatggttgac
caggatcgcaataccatatgggaacataaaaacgatattttgcgcgaatttccagaggat
ttgtctgtattgttacaatgtgtgtactggaaagatcgcgatgatgtgtccgatatttgg
tatttgctcaagatgtggccccttatatccattgaacgctcactggaactgctagactat
gcctatccagatccagcagtgcgcggattcgccatcaagtgtctgcataatctaaaagat
gaggaactgctgctgtacttattacagctggtacaggcaattaagcacgaatcgtattta
gcaaatgatttggtaatatttttgctgcaacgagctctacgtaaccaacgcattggacat
tactttttctggcatctgcggtccgaaatgcatacgccctgcatgcagacacggtttggt
ctacttctggaagcttaccttaaaggctgcaatcagcatgtaaagccactgcgaaagcaa
ctcgaggtgctagaaaagttaaaggtgggatccgtgttagccaaaaagggcagcaaggag
agagtgcgcaccgaattgcagaagtttctccgcaacgaacacaacaacggcatcttccaa
aatatacaaaaccctttaaacccgagctttagatgcaggcgcgtcacacccgacaaatgt
aaggtcatggatagcaaaatgcgaccgctctgggtagtattcgaaaacgtggatcagacg
gccaatgatgtgtacatcatatttaaaaatggcgatgatctgcgccaggacatgcttaca
ctgcaaatgttacgtgtcatggatcagttgtggaaacgtgaaggattggatttgcgtatg
aacatctacaactgcatcagcatggaacaacgattaggcatgatagaggtggttcgtcat
tcggagacaatagctaatatacaaaagttaaagggcatgttttcggcaacatcaccattt
aaaaagggctcgctctacagttggctcaaggagcacaataaggcgcccgagaaacttaac
aaagccatcaatgagtttacgctcagctgtgctggctactgcgttgccacctacgtgttg
ggcgtcgccgatcgtcattcagacaatataatggtcaagcgtaatggacagctcttccat
attgacttcggccatattttgggccactttaaagagaagttcggagtgcgacgcgaacgt
gtgccctttgtgcttacccacgactttgtctacgtcatcaacaaaggttgtattgaccgc
gaggcaaaggagttttgctacttccaggagttgtgtgagcgcgcatttttaatattacgc
aaacatggttgccttattttatcgctattctcaatgatgatttcaacgggactgccggaa
ctatcctcagagaaggacctgaactatttacgtgagactttggtgctggactacacggag
gaaaatgcacgtaaacatttccaagcgaaattcagtgaagctttggccaattcatggaaa
acgtcactgaattgggcctcccacaatttctctaaaaacaacaaacagtga

DBGET integrated database retrieval system