KEGG   Drosophila mojavensis: Dmoj_GI22170Help
Entry
Dmoj_GI22170      CDS       T01062                                 

Definition
GI22170 gene product from transcript GI22170-RA
Orthology
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
dmo  Drosophila mojavensis
Pathway
Inositol phosphate metabolism
FoxO signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
Jak-STAT signaling pathway
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:dmo00562]
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:dmo04630]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:dmo04068]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:dmo04070]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:dmo04150]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1076 aa AA seqDB search
MGDTLYISNETYMFSRFSIDLWKYDPPDTVHLTCLVFNGSTIYLHVKSTATIREVKEEIL
AQARYLPLSYMIKDACDYQICGISSYTIEPYTDETKRLFEVQPYFGLLSLRERSDSTTFS
SDYELTKMVTDIIGTSFDHQNTQGSPEVDYFRAKVTEVSDEIKLERSRYTWQQRLLYEHP
LRLANSTAMPELIRQRHPSSAFLIAVKNENDQSTFTLSVLEHDTPLSLIESTLQKMNRSQ
MKMNDRASDYILKVSGRDEYLFGDHPLIQFLYIQETLSDAAVPNVVLQSVLRLECYINHY
NEKSLGQKKPPNPNNQIAQIPLEPCNVIWNLENVNFSLTLHGVTNVNFDRARAFKVGVHV
GLYHGKRKLCSQRTVDAPSQGNSQDFQLDENVMTFDIQMRNLPRMTRLCIVVFEVTKMSR
SKKSSNNTSTLKDDFYNNNPLAWVNTTIFDYKDQLRKGRQTLYTWTYADDIQSDDVFYPL
GTVESNPRIDGCAMVHLTFHQGTNENCNDEAICYPSEDEVLQYAAERAYSNRDKQSLNME
ELGALLANYSGKDKIYEMVDQDRNTIWEHKNDILREFPEDLSVLLQCVYWKDRDDVSDIW
YLLKMWPLISIERSLELLDYAYPDPAVRGFAIKCLHNLKDEELLLYLLQLVQAIKHESYL
ANDLVIFLLQRALRNQRIGHYFFWHLRSEMHTPCMQTRFGLLLEAYLKGCNQHVKPLRKQ
LEVLEKLKVGSVLAKKGSKERVRTELQKFLRNEHNNGIFQNIQNPLNPSFRCRRVTPDKC
KVMDSKMRPLWVVFENVDQTANDVYIIFKNGDDLRQDMLTLQMLRVMDQLWKREGLDLRM
NIYNCISMEQRLGMIEVVRHSETIANIQKLKGMFSATSPFKKGSLYSWLKEHNKAPEKLN
KAINEFTLSCAGYCVATYVLGVADRHSDNIMVKRNGQLFHIDFGHILGHFKEKFGVRRER
VPFVLTHDFVYVINKGCIDREAKEFCYFQELCERAFLILRKHGCLILSLFSMMISTGLPE
LSSEKDLNYLRETLVLDYTEENARKHFQAKFSEALANSWKTSLNWASHNFSKNNKQ
NT seq 3231 nt NT seq  +upstreamnt  +downstreamnt
atgggcgatacactgtatatctccaacgagacatacatgttcagcagattctcaattgat
ctctggaagtatgatccaccggatactgtccatttaacatgcctggttttcaacggttcg
acgatctatttgcacgttaagtccacggcgaccattcgagaggtaaaagaggaaatattg
gcacaggctagatatctaccattgagctatatgattaaggatgcctgcgattatcaaata
tgtggcatctcgtcctatacgatcgagccatatacggacgaaacgaagcgtctgttcgag
gtccagccgtactttggcttgcttagccttagggaacgcagcgactcgaccaccttttct
agcgactatgagctaaccaaaatggttaccgacataattggtacatcgttcgatcatcaa
aacactcaaggttctcctgaggtagattattttcgcgctaaggtgacagaagtctccgat
gaaattaaattggagcgatcgagatatacgtggcagcagcgattgctctacgagcatccg
ctgcggcttgccaactcgacagccatgccagaactaatacgacaacgtcatccaagctcg
gcatttttgattgccgtcaagaacgagaatgatcaaagcacattcacgctgtccgtactg
gagcatgatacgccactctcattgatcgaaagcacgcttcagaagatgaaccgctcacag
atgaagatgaacgatcgcgcctccgactatatactcaaagtgagcggccgtgatgagtat
ctgtttggtgatcatccgctgatacaattcctgtacatacaagaaacgctctccgatgca
gccgtgccaaatgtggtgctgcagtcggtactgcggctcgagtgctacatcaatcactac
aatgagaaaagtctggggcaaaagaagcccccaaatccaaataatcaaatcgcacaaatc
ccattagagccctgtaatgtgatatggaatttggaaaatgtgaatttctcattaacattg
catggcgtcactaatgtcaacttcgatcgtgctcgagcctttaaagttggcgtccatgtt
ggcctctatcatggaaagcgaaaattgtgctcgcagcgcaccgtcgatgcgcctagccaa
ggcaattcgcaggactttcaattggatgaaaacgttatgacatttgatattcaaatgcgc
aatctgccacgaatgacgcgtctgtgtattgtggtattcgaagtgaccaaaatgtcgcgc
tcgaagaaatcgtctaataataccagcacgctcaaggatgacttctacaacaacaatcca
ttggcctgggtcaatacaacgatctttgactataaagatcagttgcgtaagggacgtcaa
acactatacacctggacctatgcagacgacatccagtcggatgatgtgttttatccgctg
ggcactgtcgagtccaatccacgcatagacggttgtgctatggtgcatctgacattccac
caaggcaccaatgaaaattgcaacgacgaagctatctgttatcctagcgaggatgaagtt
ctacaatatgcagcagaacgagcgtactccaatcgtgataagcaatcgctaaatatggag
gagcttggtgccctattggcgaattattcgggcaaagacaaaatttacgaaatggttgac
caggatcgcaataccatatgggaacataaaaacgatattttgcgcgaatttccagaggat
ttgtctgtattgttacaatgtgtgtactggaaagatcgcgatgatgtgtccgatatttgg
tatttgctcaagatgtggccccttatatccattgaacgctcactggaactgctagactat
gcctatccagatccagcagtgcgcggattcgccatcaagtgtctgcataatctaaaagat
gaggaactgctgctgtacttattacagctggtacaggcaattaagcacgaatcgtattta
gcaaatgatttggtaatatttttgctgcaacgagctctacgtaaccaacgcattggacat
tactttttctggcatctgcggtccgaaatgcatacgccctgcatgcagacacggtttggt
ctacttctggaagcttaccttaaaggctgcaatcagcatgtaaagccactgcgaaagcaa
ctcgaggtgctagaaaagttaaaggtgggatccgtgttagccaaaaagggcagcaaggag
agagtgcgcaccgaattgcagaagtttctccgcaacgaacacaacaacggcatcttccaa
aatatacaaaaccctttaaacccgagctttagatgcaggcgcgtcacacccgacaaatgt
aaggtcatggatagcaaaatgcgaccgctctgggtagtattcgaaaacgtggatcagacg
gccaatgatgtgtacatcatatttaaaaatggcgatgatctgcgccaggacatgcttaca
ctgcaaatgttacgtgtcatggatcagttgtggaaacgtgaaggattggatttgcgtatg
aacatctacaactgcatcagcatggaacaacgattaggcatgatagaggtggttcgtcat
tcggagacaatagctaatatacaaaagttaaagggcatgttttcggcaacatcaccattt
aaaaagggctcgctctacagttggctcaaggagcacaataaggcgcccgagaaacttaac
aaagccatcaatgagtttacgctcagctgtgctggctactgcgttgccacctacgtgttg
ggcgtcgccgatcgtcattcagacaatataatggtcaagcgtaatggacagctcttccat
attgacttcggccatattttgggccactttaaagagaagttcggagtgcgacgcgaacgt
gtgccctttgtgcttacccacgactttgtctacgtcatcaacaaaggttgtattgaccgc
gaggcaaaggagttttgctacttccaggagttgtgtgagcgcgcatttttaatattacgc
aaacatggttgccttattttatcgctattctcaatgatgatttcaacgggactgccggaa
ctatcctcagagaaggacctgaactatttacgtgagactttggtgctggactacacggag
gaaaatgcacgtaaacatttccaagcgaaattcagtgaagctttggccaattcatggaaa
acgtcactgaattgggcctcccacaatttctctaaaaacaacaaacagtga

DBGET integrated database retrieval system