KEGG   Drosophila mojavensis: Dmoj_GI22300Help
Entry
Dmoj_GI22300      CDS       T01062                                 

Definition
GI22300 gene product from transcript GI22300-RA
Orthology
K04437  
filamin
Organism
dmo  Drosophila mojavensis
Brite
Exosome [BR:dmo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dmoj_GI22300
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 275 aa AA seqDB search
MFRVSQEIRLNSSAAGAAGQAQGLADVGDVSSSAESCCIFGRYQRTPDADAYPTEPPHVY
VAPELTDAGKVQLLHLPSGAVRVNSTISFVIKRNGVKGNFDVRLETPSGQHGAPLQLTQL
DPERFQVECQLTQAGLYKVHIKCNSVPLPKSPYIIVTIAGAATPIEDGNEHAASNPSMPH
FESDASKVQSRGLGLTHVNLLERNEFTVDASSAGSNMLFVGILGPQGPCDEVLVKHLGRH
VYRVAYQVRDPGDYTLVVKWGEQHIPGSPFSLCAE
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgttccgagtgtcgcaggagattcgcttgaattcgagcgcagcgggcgccgcggggcag
gcccaggggctggccgatgtcggcgatgtcagcagcagtgcggagagttgttgtattttc
ggtcgataccagcgcacgcccgatgcggatgcgtatcccacagagccgccacatgtctat
gtagcgcccgagctgaccgacgcgggcaaggtgcagttgctgcatttgcccagcggcgcg
gtgcgcgtcaattccacgattagcttcgtcatcaagcgcaatggggtgaagggcaatttc
gatgtgcgcctcgagacacccagcggacagcacggagcgccactgcagctgacgcagctg
gatccggaacgctttcaggtggaatgtcagctgacgcaggcgggcctctataaggtgcac
atcaagtgcaattccgtgccactgcccaagtcgccctacattatagtcaccatagctgga
gcggcgacaccaattgaggatgggaacgaacatgccgccagcaatccatctatgccccac
ttcgaatccgatgccagcaaagttcagagtcgcggcctgggtctgacccatgtcaatctg
ctcgagcggaacgagttcacggtggatgccagctctgccggcagtaatatgctctttgtg
ggtatactgggaccgcagggaccatgtgatgaggtgctggtcaagcatctgggccggcat
gtataccgtgtcgcgtaccaggtgagggatccgggcgactacactctggtggtcaagtgg
ggtgaacaacacattccaggatcaccttttagcctctgtgccgagtaa

DBGET integrated database retrieval system