KEGG   Drosophila mojavensis: Dmoj_GI22313Help
Entry
Dmoj_GI22313      CDS       T01062                                 

Definition
GI22313 gene product from transcript GI22313-RA
Orthology
K04348  
serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
dmo  Drosophila mojavensis
Pathway
Wnt signaling pathway
Class
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:dmo04310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 628 aa AA seqDB search
MSTTTRSSLTRKSSLSKSSTTDKTTKSTTKSTTTKSSSNSATTTTTTTEATGTGSKQKMQ
YTKTRERIVDDVPLPPTHKLTMSEVYDDPKTGKPNFDVLRQHFLLEGRIEESVALRIINE
GADLLREEKNMIDVEAPITVCGDIHGQFFDLVKLFEVGGPPATTRYLFLGDYVDRGYFSI
ECVLYLWALKITYPDTLSLLRGNHECRHLTEYFTFKQECIIKYSESIYDACMEAFDCLPL
AALLNQQFLCIHGGLSPEIFTLDDIKTLNRFREPPAYGPMCDLLWSDPLEDFGNEKTTEF
FSHNSVRGCSYFFSYAACCEFLQKNNLLSIVRAHEAQDAGYRMYRKNQVTGFPSLITIFS
APNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVN
VLNICSDDELVAGPDDELEEELRKKIVLVPATVNNNNNNNTPSKPASMSALRKEIIRNKI
RAIGKMSRVFSVLREESESVLKLKGLTPTGALPMGALSGGRDSLKEALQGLTAASQIHSF
AEAKGLDAVNERMPPRRPLSMSASSSSITTINSTTTTSNSSTNNNNNNNTETTKNSNSDA
TLTKTSRTTVRSATTSNVRSGYTSKRFS
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgtccacgacgacgcgaagttcactgacgagaaaatcgtcgctgtccaaaagtagcacc
acggacaaaacaaccaaatcaactacgaaatcaacaacaacaaagtcatccagcaatagt
gcaacaacaacaacaacaacaacagaagcaacggggacaggcagcaaacagaaaatgcaa
tacacaaagacgagggaacgcattgtcgatgatgtgcccctgccgcccacacacaaactg
accatgtccgaggtctacgacgatcccaaaacgggcaagcccaatttcgatgtactgcgt
cagcactttctcctcgagggccgcatcgaggaatccgtcgccctgcgcatcatcaacgag
ggcgccgatctgctgcgcgaggagaagaatatgatcgatgtggaggctccgattaccgtc
tgcggcgacattcacggtcagttcttcgacttggttaagctcttcgaggttggcggaccg
ccggctaccacgcgttacctcttcctgggcgactacgtggacaggggctacttcagcata
gagtgtgtgctctatctgtgggccctgaagatcacctatcccgacacgctgtctctgctg
cgcggcaatcacgagtgccgccacctaacggaatacttcacctttaaacaggagtgcatt
attaaatattcggaaagtatttacgatgcgtgcatggaagcgttcgattgcctgcccctc
gccgcgctgctcaaccaacagtttctgtgcatacacggcggtctatcgcctgagattttc
acactcgacgacatcaagacgctgaatcgattcagggagccgcccgcctatgggcccatg
tgtgatctgctatggtccgatccgttggaggattttggcaatgagaagaccaccgaattc
ttctcacacaattcggtgcgcggctgttcctatttcttcagctacgcggcctgctgtgag
tttctgcaaaagaacaatctgctctccatagtccgggcgcatgaggctcaggatgcgggc
tatcgcatgtatcggaaaaatcaggtaacgggcttcccctcgctgatcaccatcttctcg
gcgcccaactatttggatgtttacaacaacaaggcagctgtgctcaagtacgagaacaac
gtgatgaacataagacaattcaactgctcgccgcatccctactggctgcccaacttcatg
gatgtcttcacctggtccctgccctttgttggcgaaaaggtcacggagatgctggttaat
gttctcaacatttgctccgacgacgagcttgtcgcaggccccgatgacgagctggaggag
gagctacgcaagaaaattgtgctcgtgccggcgacagtgaataataacaataacaataat
acgcccagtaagccagcttctatgtcggcgctgcgcaaggagataattcgcaacaaaata
cgcgccattggcaaaatgtcgcgtgtcttttcggtgctgagagaagagtcggagagcgtg
ctgaaactaaagggcctgacgcccacgggcgcattgccaatgggcgcgctgtctggtggg
cgtgattcactcaaagaggcgctgcaaggactgaccgcagcctctcagattcattccttt
gccgaggcgaagggcctggacgctgtcaatgagcggatgccgccgcgtcgtccgctgtca
atgagcgccagcagcagcagcatcaccaccatcaacagcaccaccaccaccagcaacagc
agcaccaacaacaacaacaacaacaacacagaaaccaccaagaatagcaacagtgatgcc
acgctaacaaaaacgagccgaacgaccgttagatcagcgaccacaagcaacgtgcgcagc
ggctacacctcgaagagattctcatag

DBGET integrated database retrieval system