KEGG   Drosophila mojavensis: Dmoj_GI22314Help
Entry
Dmoj_GI22314      CDS       T01062                                 

Definition
GI22314 gene product from transcript GI22314-RA
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
dmo  Drosophila mojavensis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dmoj_GI22314
Enzymes [BR:dmo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Dmoj_GI22314
Exosome [BR:dmo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dmoj_GI22314
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 586 aa AA seqDB search
MQSVLLILLGISLGAWSATVQPPPVIQTLSAAGSNGIGPEFQVTEKQDPASEDAQFWRQV
GLKQLSKTIEKAKRAKDSSYQHKAKNIIIFIGDGMGLSTISAGRIYKGQYLKHGHGEEEM
LSFDEFPFTGLAKTYNVDKQVPDSAGTATAIFSGVKTDYGAIGMDSTRSTTNASQGRLDS
IMDWAQREGKRTGVVTTTRITHATPAATYARIYHRDWECDTEVPQESVGIHADIARQLVE
NAPGNKLNVVLGGGLSPMGAFNESEVKTVQFEGGTETICKRGDNRNLATEWLQRHANDSK
EAKLVYTREQLLQVDVKEVDHLMGLFRNNHITYSIAREEGEPSLQDMTEAAIGVLERGDK
SKGYVLLVEGGRIDQGHHQNYARAALHEVYELDLAVQAALKMTDSDETLIIVTADHSHSV
TFNGYPERGADILGAANLHKPKDPMVYETITYANGPGYFDHLANETKPANSSNVWRPLKM
YTKEQIESPTYRHMATLALKDETHGGEDVIVFASGPGSSLVRGVFEQNYLAYVMSYAGCM
GPVKSFDESCQRHLSSAGHSKSESSAAALRLTLLPLLAAWLIVQLL
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgcaatcggttctattgatactcctcggcatctcactgggcgcctggtcggccacagtg
cagccgccgccagtgatacaaactctgagcgcagcgggaagtaacggcattgggcccgag
ttccaagtcaccgagaagcaggaccccgcctcggaagatgcccaattctggcggcaagtg
ggcctaaagcagctgagcaaaactattgagaaggcgaagcgggccaaggacagctcctat
cagcacaaggccaagaacattatcatcttcattggcgatggcatgggcctgtccacgatc
agtgccggtcgcatctacaagggacagtatctgaagcatggccatggcgaggaggaaatg
ctgtcctttgacgagttccccttcacaggcttagccaagacctacaacgtggacaaacag
gtgccggattcggcgggcacagccacggccatattctctggcgtcaagaccgactatgga
gccattggcatggactcgacgcgctcaacgacgaacgccagccagggtcgactcgactcc
atcatggactgggcacagcgtgagggcaagcggaccggcgtcgtgactaccacgcgtata
acacacgccacacctgcggccacctatgcaaggatctatcatcgggactgggagtgcgac
acggaagtgcctcaggagtcagtgggcatccatgcggacattgcgcgccagctggtggag
aatgcgcccggcaacaagctgaacgtggtgctaggcggcggcttgtcgcccatgggcgcg
ttcaacgagtcggaggtgaagaccgtccagttcgaggggggcaccgagactatttgcaag
cgcggcgataatcgcaatctggccaccgagtggttgcagcgacatgccaatgacagcaaa
gaggcgaagctggtctacacgcgcgaacagctgctccaggtggatgtgaaggaggtggat
catctgatgggcctgttccgcaacaatcacatcacctactccattgcccgtgaggagggc
gagccctcgctgcaggacatgacggaggcggcgatcggagtgctggaacgtggcgacaag
tcgaagggctatgtgctgctggtcgagggcgggcgcattgaccagggtcatcatcagaac
tatgctcgcgctgccttgcacgaggtctacgaactggacctggccgtgcaggcggcgctg
aagatgaccgattcggatgagacgctgattatagtgacggcggatcattcgcattctgtc
acattcaatggctatccggagcgtggagctgatatattgggtgctgcgaacttgcacaag
cccaaggatcccatggtgtatgagaccatcacctatgccaatggacccggctactttgac
cacttggccaatgagacaaagcccgcaaacagctccaatgtgtggcggccgctcaagatg
tacaccaaagaacaaatcgaatcacccacctaccgccacatggccacgctggcgctgaag
gacgagactcacggcggcgaggatgtgattgtctttgccagcggtccagggtctagtctg
gtgcgcggtgtcttcgagcagaactacttggcctatgtgatgagctatgccggctgcatg
ggtccagtgaagagtttcgatgaatcgtgccagcgccatctgtcgtccgccggccacagc
aagagtgaaagtagtgccgctgcgctgagactcacgctgctgccgctactcgccgcttgg
ctgatcgtgcagctgctgtaa

DBGET integrated database retrieval system