KEGG   Drosophila mojavensis: Dmoj_GI22315Help
Entry
Dmoj_GI22315      CDS       T01062                                 

Definition
GI22315 gene product from transcript GI22315-RA
Orthology
K09270  
transcription factor SOX7/8/10/18 (SOX group E/F)
Organism
dmo  Drosophila mojavensis
Brite
Transcription factors [BR:dmo03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   HMG SOX
    Dmoj_GI22315
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 536 aa AA seqDB search
MSANTNTERAKPVETLVLANYALKAEQKRAAGQGGRKEDERITSAVMKVLEGYDWNLVQA
SAKAPSDRKKEHIKRPMNAFMVWAQAARRVMSKQYPHLQNSELSKSLGKLWKNLKDSDKK
PFMEFAEKLRMTHKQEHPDYKYQPRRKKARLMPQSEAASTAATVTATPATATAATATASS
TTARRSSGGQAPQRRTSKANNNNCASSNLCTTSNGSNGSNGSTATSTSDVFSNEAFMKSL
NSACAASLLEQGLSLGSETERGLLDSPCSTASSMSSLTPPATPYTGVAKPTTGNSLLLRQ
LSEPSGGGGGNNNNDYGVLLDAGREYIALGELNYTAQNGNGVGMGVGVGVGVGVSVGGVQ
EMDFLENISGYSYGTRGSYTSYGYNGSSFPAAAAASASHANGALNYLGKPAAVDIDPKEM
DQYLMDQMLPLTQQHMPTAPAAVAAHSPPLNSSASLSSACSSASSQPVECLASPSAYYDH
MGSYPAQAQTNNIGYAHYVPETQQQQQQQQQQHEQQQQLSQQQQQQPHLWGTYVNP
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccaatacgaatacggaacgcgccaagcccgtggagactttagtcctggccaac
tatgcactgaaggccgagcagaaacgcgccgccggccaaggcggacgcaaggaggatgag
cgcatcaccagcgccgttatgaaggtcctggagggttacgattggaatctggtccaagcc
tctgccaaagcaccttccgatcgcaaaaaggagcacatcaagcgacctatgaacgccttc
atggtctgggcccaagcagcacgtcgcgtcatgtccaagcaatatccacatctgcaaaac
tcggagctgagcaagtcgctgggcaagctatggaaaaatctgaaggatagcgataagaag
ccgttcatggaattcgccgagaagctgcgcatgacgcacaaacaggagcatcccgactac
aaatatcagccgcgtcgcaaaaaggctcgcctcatgccacagtcggaggcagctagcacg
gcagcaacagttactgccacgccagcaacagcaacagcagcaacagcaacagcaagttcc
actacagcgcgtcgcagctccggcggccaagcaccgcagcgccgcacgagcaaagccaac
aacaacaactgcgccagctccaatctgtgcaccaccagcaacggcagcaatggcagcaat
ggcagcaccgccaccagcaccagcgacgtcttcagcaacgaggcattcatgaagtcgctg
aacagcgcctgcgcggccagcctgctggagcagggcctctcgctgggcagcgaaacggag
cgcgggctgctcgactcgccgtgctcgacggccagctcgatgtcatcgctgactccgcca
gccacgccctacacgggcgtggccaagccgacaacgggcaacagtctgctgctccggcag
ctgagcgagccgagcggcggcggcggcggcaacaacaacaacgactacggcgtgctgctg
gacgcgggtcgagaatatattgcgctgggcgagctgaactacacagcacagaacggaaac
ggcgtgggtatgggcgtgggcgtgggagtaggagtgggcgtaagtgtgggcggtgtgcag
gagatggactttctggagaacatcagcgggtatagctatggcacgcgtggcagctacacc
agctacggctacaacggtagcagctttccagctgccgcggcggcatcagcgtcacacgcc
aatggagcgctaaattacttgggcaagccggcggcagtcgacattgatcccaaggaaatg
gaccagtatcttatggatcaaatgctgcccctaacgcaacagcatatgccaaccgcgccc
gccgctgtggccgcacactcgccgccgctcaactcatccgcctcgctgtcttcggcctgc
tccagcgccagctcccagcccgtcgagtgcctggcctccccgagcgcctactacgaccac
atgggcagctacccagcgcaggcccagactaataatattggctatgctcactatgtgcct
gaaacccagcagcaacagcaacagcagcaacagcaacatgagcaacagcaacagctgtcg
cagcagcagcagcagcagccacatctttggggcacttatgtgaatccctaa

DBGET integrated database retrieval system