KEGG   Drosophila mojavensis: Dmoj_GI22639Help
Entry
Dmoj_GI22639      CDS       T01062                                 

Definition
GI22639 gene product from transcript GI22639-RA
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
dmo  Drosophila mojavensis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 404 aa AA seqDB search
MAQIQEYQDLVLDALEAVEFKLIRDKADINNDALIFHPAMAHQIFGESETIFGYQGLHVR
VLYTAGPLHIYLGVEYEKRVNEISGGEIKADDVVATIAQSLPDGCYFINLDEFLKTLDKA
DKFQPFGEKLSEYSRRADDGSERLFEIYQCDYKSSSFLKFFTRLQTFILWFVDAASYIDT
DDAQWCYFICYEKYKNKDGEYQYATAGYTTVYEYYAYPQNKRPRISQMLILPPFQKLGLA
TQLVETIYKFYQSQKNVVDITVEDPSEDFQRLRNFVDARLCLELKCFSRDIIKKGFTKEM
VREARETLKLNPRQVRKVYELLRLYYTNVADEKEYRAYRLEVKKRLNAVYYKQLKDLQKM
ERYKMDTEMLRARLPNAKQRMEQLQEEYALIEQDYKNTIDKLRA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggcacaaattcaggaatatcaggatctggtgctcgatgcccttgaggcagtggagttc
aagctgatacgcgacaaggcggacattaacaacgatgccttaatatttcaccccgccatg
gcgcatcagatatttggtgagtcggagaccatattcggctatcaggggctgcacgtgcga
gttctgtatacggctggcccgttgcatatctatctgggcgttgagtacgagaagcgagtc
aatgaaatatctggtggagaaatcaaagctgacgacgtggtcgccacaattgctcaaagt
ctaccagacggctgttatttcattaatttggatgagtttctcaagacgcttgacaaggcc
gacaagtttcagccatttggtgaaaaactcagcgaatacagtcggcgcgccgacgatggc
agcgaacggctcttcgaaatctatcaatgtgactacaaatcgtcgtcatttctaaagttc
tttacgcgtctgcaaacgttcatattatggtttgttgacgctgcctcctatatagacacc
gatgatgcccagtggtgttactttatctgctatgagaaatataagaataaggatggcgaa
taccagtatgcaactgctggctacaccactgtctatgagtactatgcatatcctcagaat
aagcgtccgcgaattagccaaatgctaattttgccgccattccagaaattgggtttggct
acacagctagtggaaacaatatacaagttctatcagagccagaagaatgtggtggacata
accgtagaggatccatccgaggactttcagagattgcgtaactttgtggacgcccgtctg
tgtctggagctgaaatgcttttcccgtgatataatcaagaagggtttcaccaaggaaatg
gtgcgcgaggcacgcgagaccttgaaactgaatccacgtcaggtgcgcaaggtatacgaa
ttgttgcgcctatactacaccaacgtggctgatgaaaaggaatatagagcctatcgtctg
gaagttaagaaacgcctcaatgccgtttactacaaacagctgaaggatcttcagaagatg
gaacgctataaaatggatacggagatgttgcgggcacgtttgccaaatgccaaacagcgc
atggaacagctgcaggaggagtatgcgctcatcgagcaggattacaagaatacaattgat
aagctacgggcctag

DBGET integrated database retrieval system