KEGG   Drosophila mojavensis: Dmoj_GI22693Help
Entry
Dmoj_GI22693      CDS       T01062                                 

Definition
GI22693 gene product from transcript GI22693-RA
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
dmo  Drosophila mojavensis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dmoj_GI22693
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dmoj_GI22693
  Amino acid metabolism
   00310 Lysine degradation
    Dmoj_GI22693
Enzymes [BR:dmo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Dmoj_GI22693
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 482 aa AA seqDB search
MAGIISILTRQLPRNVQTVGLKAVRNHELQLSARQYSQLAVVAALQQQHQLLRRETNPTL
RCQDAMRSLGWQSFHTTSSMWSEQVVKVPPFADSITEGDIKFTVKVGDSFGADEAVMEIE
TDKTTMPVPAPFAGTVTEILVKDGDTVKPGQELFKLKPGAAPAKPAGAPAPAKEAPAPAP
AAAAPPKPAAPAAAPAPAAPKSAPPPPPPPAARPPPAAPRAAAPPPAAVRPAVAQVKVPP
VDGSRQILGTRSEQRVKMNRMRQKIAARLKDAQNTCAMLTTFNEIDMSYAMDFRKQNLDA
FTKKYGIKLGFMSIFSKASAYALQDQPVVNAVIDGQDIVYRDYVDISVAVATPRGLVVPV
IRNVESMNYADIEIALAGLADKAKRDAITVEDMDGGTFTISNGGVFGSLMGTPIINPPQS
AILGMHGIFDRPIAVKGEVKIRPMMYVALTYDHRIIDGREAVLFLRKVKAAVENPSIIVA
GL
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcattatttcaatattaacgaggcaattgccgcgcaacgtgcaaaccgttggc
ctaaaagctgtgcggaatcatgaactccagctgagtgcccgtcagtattcccagctggct
gtggttgctgcattgcagcaacagcaccaactgttgcgtcgggaaacgaatcctactctg
cgctgccaagatgcgatgcgttctttgggctggcagagctttcacaccaccagcagcatg
tggtcagagcaggtagtgaaggtgccgccgttcgccgactccatcaccgaaggtgacatt
aaatttaccgtcaaagtgggcgactcgttcggggccgatgaagctgtcatggagatcgaa
acggataagacaactatgccagttcctgcaccctttgctggcaccgtgacggaaattcta
gtcaaggacggtgacacggttaagcccggccaggaactttttaaattgaagcccggcgca
gctcctgctaagccagctggagcacccgccccagccaaggaggcaccagccccagcccca
gctgcagctgctccacctaagccagcggcaccagctgccgctcctgcacccgctgcgcca
aaatcagccccaccaccgccaccacctccagcagcgcgcccgccaccagctgctccccgt
gctgccgctccaccaccagctgccgtcaggcctgccgtggctcaggtgaaagtgcctcct
gttgatggttcccgtcaaatcttgggtacgagatccgagcaacgcgtcaagatgaaccgc
atgcgccaaaagatcgcggctcgcttgaaggatgcacagaacacgtgcgccatgttgacc
actttcaatgaaatcgacatgagctatgctatggacttccgtaagcaaaatcttgatgca
ttcaccaagaagtatggcatcaaacttggtttcatgtccatcttctcgaaagccagtgcc
tatgcgctgcaagaccagcctgttgtcaacgccgtcatcgatggccaggatattgtttac
cgtgactatgtggatatctcagtagccgttgctacgccccgtggtctggttgtgcccgtc
attcgtaacgttgagagtatgaactatgcggacattgagatagctttagctggattggcc
gacaaagccaaacgtgatgccatcaccgttgaggatatggacggcggcaccttcaccatc
agcaacggtggtgtgtttggctcgctgatgggcacgcccatcatcaatccacctcagagt
gctatacttggcatgcatggcatctttgatcgtcccattgctgtcaagggcgaggtcaag
atcaggccaatgatgtacgttgccctgacatacgatcaccgaatcattgatggacgtgag
gctgtgttgttcctgcgtaaggtgaaggctgccgtagagaatccatctatcattgttgcc
ggtctgtaa

DBGET integrated database retrieval system