KEGG   Drosophila mojavensis: Dmoj_GI22758Help
Entry
Dmoj_GI22758      CDS       T01062                                 

Definition
GI22758 gene product from transcript GI22758-RA
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
dmo  Drosophila mojavensis
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    Dmoj_GI22758
Enzymes [BR:dmo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Dmoj_GI22758
Peptidases [BR:dmo01002]
 Metallo Peptidases
  Family M67
   Dmoj_GI22758
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 419 aa AA seqDB search
MSKAVNNMNMGVVEPQQRIKNLSHCGNLIDVDKNMKVSRYYRAGTEILRMANVYLNEGDH
ENAFILYMRYMTLFIEKIRQHPDYGSVKAEVKAINKTIKDEIMPTTEKLRNKLLAQYQRE
YEQFLANKEAERMREQERERQQQMANKKAATASSIPSLIPANLHVQMDPSSQPTAPDLNL
LDQVVYPNDFPTGTNRNNLPNSGLLLPMAAEAGAADKIANSSSKPAFDRSRKPQFNRTDS
LLAGSLRCVNVPGDTMDVFLKLAHANTSNNIETCGVLAGHLAHNELYITHIIAPQQQGTP
DSCNTMHEEQIFDVQDQMQLITLGWIHTHPSQTAFLSSVDLHTHCSYQMMMPEAIAIVCA
PKYNTTGFFLLTPHYGLDYIAQCRQSGFHPHPNDPPLFMDAQHIKIDAQTKIKVIDLRR
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaggccgtgaataacatgaacatgggcgttgtggagccacagcagcgcattaaa
aatctctcccactgcggcaacctcatcgatgtggacaagaatatgaaagtgtcgcgctat
taccgcgccggaacggagatcctgcgcatggccaacgtctatctgaatgagggcgaccat
gagaatgcatttatattatacatgcgctacatgacgttgttcattgagaagatacgccag
catccggactatggcagcgttaaagctgaagtgaaggccatcaataagacgattaaggac
gagatcatgcccacaacggagaagctgcgcaacaagttgctggcccagtaccaacgtgaa
tacgaacagtttctggccaacaaggaggcggagcgaatgcgcgaacaggagcgagagcgc
cagcagcagatggccaacaagaaggcagcgacagcttcatctattccttccctcataccc
gccaatctgcacgtacaaatggatcccagcagccaacctacggccccagatctgaatctg
ctcgatcaggtggtctatccaaacgattttcccacgggcaccaaccgtaacaacctgccc
aactcgggtctcctattgccgatggcagctgaggctggtgccgccgacaagattgccaac
tcgtcatcaaagcccgcattcgatcgcagccggaagccgcagttcaatcgcaccgactcg
ctcttggccggctcactgcgctgcgtcaatgtgcccggcgacaccatggatgtgttcctg
aagctggcgcatgccaatacctccaataacatcgagacttgcggcgtcctcgccggccac
ctggcccacaatgaactctatataacgcatattattgcgccccagcagcagggcacgcca
gacagctgcaacacgatgcacgaggagcagatcttcgatgtccaggatcaaatgcagctc
attacgcttggctggatacatacccatcccagccagacggcctttctgtcctccgttgac
ttgcacacgcactgctcctaccagatgatgatgccggaggcaatcgccatcgtctgtgcg
cccaaatacaatacaactggtttcttcttactcacgccgcattatggcctggactacatt
gcacagtgccggcaaagcggatttcacccacatcccaatgatccgccgctcttcatggat
gcacagcacatcaagatagatgcccagaccaagatcaaggtcatcgatctgcgcagatag

DBGET integrated database retrieval system