KEGG   Drosophila mojavensis: Dmoj_GI22783Help
Entry
Dmoj_GI22783      CDS       T01062                                 

Definition
GI22783 gene product from transcript GI22783-RA
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
dmo  Drosophila mojavensis
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:dmo00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:dmo00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:dmo04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 562 aa AA seqDB search
MNLRWLWMLFAVALWPGWAAALSTPCQLKETQYGSVCVCNSSYCDYLEQPELQDDNQIVV
ISSSKNGLRFTRSEGSFLDKNILEVKDHQWIDNNFVADAVVVEQNKVWLQFANVPQRFAI
NVNIKTVQLTVQREKRYQKITNFGGAFTGSVSHILQQLPKALQDHVYRSYFHADGIAYNS
IRMSIGGSDFDLLPWAYNQLPRNDPTLSNFTSLDPRDLQKIEQLKRLKAVAKLSNLKIMA
AAWSAPPWMKSNNRWTGYGQLKAEYYQAWADYHLKFLELMQSKNMTVWAISTGNEPLNGV
IGFFFVHFMSMGWTPWQQAIWLNDYLGPTIRKSKQSQVLIFGNDDQRYTYPSWFRKMRTS
RSTALDYLDGLAVHWYWDEIFGPHCIDRAHAEMPDKLLLNTESCIGDKPWQTHGPELGSW
GRGESYMRAYIQDLLHHFNGWLDWNLVLDERGGPNYVHNYVDAPVIVNTTSRTEFYKQPI
YYAIGHFSKFLPEESVRIEAITNETESFPQLSVVGFQRPDGSVALIVYNGENLPVNVALN
DSQRGAFSLRLPARSWHTVVYK
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgaatctgcgctggctgtggatgctgttcgctgttgccctttggccaggatgggcagct
gcgctatcgacgccttgtcagctaaaggagacgcagtacggcagcgtatgcgtctgtaat
agcagctactgcgattatctggagcagccggaactacaagatgataatcagattgtggtg
attagctcgagcaagaatggattacgtttcactcgatccgagggcagctttttagacaaa
aacatcttggaagtgaaagatcatcaatggattgacaataacttcgttgccgatgcggtt
gtcgttgagcaaaataaagtttggctgcaattcgcaaacgttcctcaacgatttgccatc
aatgtgaacataaaaacggtgcagttaacagttcagcgcgaaaagcgttatcagaagata
acgaacttcggaggcgcattcacgggcagcgtctctcacatcttacagcagctaccaaaa
gccctgcaggatcatgtctatagatcctatttccacgccgatggcattgcatacaattcg
atacgcatgtcgatcggtggatccgactttgatctactgccctgggcctacaaccaactg
ccccgcaatgatcccacactcagcaactttacctcactggacccgcgtgatcttcagaag
attgagcagttgaaacgtctaaaagcggttgccaaattaagtaatctgaaaattatggcc
gccgcttggagtgcgcccccttggatgaagagcaacaacagatggacgggctacggtcag
ctgaaagcggaatactatcaagcctgggcggactaccatttgaaattcctcgagctgatg
cagtctaaaaatatgaccgtctgggccatatccaccggcaatgagccgttaaacggtgtc
atcggcttcttcttcgtgcacttcatgagcatgggctggacgccctggcagcaggcaatt
tggctcaacgattatctaggaccgaccattaggaagtccaagcagagccaagttctcatt
ttcggcaacgacgatcagcgctatacgtatccctcctggtttcgcaagatgcgcacctct
cgcagcactgcactcgattatctcgatggcctggccgtgcattggtattgggatgagatc
tttgggccacactgtatagatcgggcgcatgcggaaatgccagataaattgctgttgaac
acggaatcttgcatcggtgacaagccctggcagacgcatggcccggagctgggcagctgg
gggcgtggcgagagctatatgcgtgcctacatacaggacttgcttcatcattttaacggc
tggctggactggaatctggtgctcgacgagcggggcggcccgaactatgtgcacaattat
gtggatgctccggtgattgtgaacacaacgagtcgcacggaattctacaaacagcccata
tactatgcaatcgggcacttcagcaagtttttgccagaggaatccgtgcggatcgaggcg
atcaccaatgagacggagtcctttccgcagctgagcgtggtaggcttccagaggccggat
ggcagcgtggcgctgatcgtgtacaatggcgaaaacctgcccgttaatgtggcgctcaat
gacagtcagcgcggtgcattcagcttgcgcctgcccgcccgctcttggcacaccgtcgtc
tacaaatga

DBGET integrated database retrieval system