KEGG   Drosophila mojavensis: Dmoj_GI22788Help
Entry
Dmoj_GI22788      CDS       T01062                                 

Definition
GI22788 gene product from transcript GI22788-RA
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
dmo  Drosophila mojavensis
Pathway
mRNA surveillance pathway
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:dmo03015]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 302 aa AA seqDB search
MGDVMNIDSIISRLLEVRGARPGKNVQLSESEIRGLCLKSREIFLSQPILLELEAPLKIC
GDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLR
GNHECASINRIYGFYDECKRRYTIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLSS
MEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTMGWGENDRGVSFTFGAEVVAKFLEKHEFD
LICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDDSLMCSFQILKPADKR
KK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgggcgatgttatgaatatcgacagcatcatatcaagacttctggaagtgcgtggggca
cggcctggcaaaaatgttcagctctccgagagcgaaattcgtggcctctgtctgaagtcg
cgagagatttttctgtcgcagcccatactcttagagctggaagcaccattgaagatttgc
ggcgacatacatggccaatattacgatttgttgcgcctattcgagtacggtggcttcccc
ccggaatcaaattacctatttttgggcgactacgtcgatcgtggcaaacagtctctggaa
accatctgcttgctgctcgcctataagatcaaatactctgagaacttctttttgcttcgc
ggtaaccatgaatgtgccagcataaatcgcatctatggattctacgacgagtgcaagcgc
cgttacaccatcaaattgtggaagacattcactgactgcttcaactgcttgccagtggca
gccattgtggatgagaaaatattctgttgccatggtggtctcagtccggacctatcgtcg
atggagcaaattcgacgcatcatgcgtcccaccgatgtaccagatcagggcctactttgc
gatttactgtggtccgatccggacaaggacaccatgggctggggcgagaatgatcgtggc
gtcagtttcacctttggcgccgaggtggtggccaaatttttagagaagcacgagttcgat
ctcatttgccgcgcccatcaggtcgtcgaggatggctatgagttcttcgcaaagcgccaa
cttgttacacttttctcggccccgaattactgtggcgaatttgacaatgctggcgcaatg
atgtctgtggatgactcccttatgtgctcattccagatattgaaaccggcagacaagcgt
aaaaagtaa

DBGET integrated database retrieval system