KEGG   Drosophila mojavensis: Dmoj_GI22929Help
Entry
Dmoj_GI22929      CDS       T01062                                 

Definition
GI22929 gene product from transcript GI22929-RA
Organism
dmo  Drosophila mojavensis
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 284 aa AA seqDB search
MDAIKKKMQAMKLEKDNAIDKADTCENQAKDANSRADKLNEEVRDLEKKFVQVEVDLVTA
KEQLEKANTELEEKEKLLTATESEVATLNRKVQQIEEDLEKSEERSTTAQQKLLEATQSA
DENNRMCKVLENRSQQDEERMDQLTNQLKEARMLAEDADTKSDEVSRKLAFVEDELEVAE
DRVRSGESKIMELEEELKVVGNSLKSLEVSEEKANQRVEEFKREMKTLSIKLKEAEQRAE
QAEKQVKRLQKEVDRLEDRLFHEKEKYKAICDDLDQTFAELTGY
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggacgccatcaagaagaagatgcaagcgatgaagcttgagaaggataatgccattgat
aaggcagatacctgcgagaatcaagctaaggatgccaactcccgtgccgacaaactcaat
gaggaggtgcgcgacttggagaagaaatttgttcaggttgaggtcgatttggtcaccgcc
aaggagcagctggagaaggccaacaccgaattggaggagaaggagaaactgttgaccgcc
acggaatccgaggtagccaccttgaaccgtaaggtgcaacagattgaggaggatttggag
aaatctgaggagcgctcaaccaccgcacaacagaagctgttggaggccacacagtcggcc
gatgagaacaaccgtatgtgcaaagtattggagaaccgttcccagcaggatgaggagcgt
atggatcagttgaccaaccaattgaaggaagctcgcatgcttgctgaggatgccgatacc
aagtccgatgaggtctcccgcaagctggccttcgttgaagacgagctcgaagtggctgag
gatcgtgtccgctccggtgaatccaagatcatggagctggaggaagaactgaaggttgtc
ggcaactcgctgaaatctttggaagtgtccgaggagaaggccaaccagcgcgttgaggaa
ttcaagcgtgagatgaagaccttgtctatcaagttgaaggaggccgaacagcgcgccgaa
caggctgagaagcaagtcaagcgcctgcagaaggaagtcgacaggctagaagaccgtctc
ttccatgagaaagaaaaatacaaagcaatctgcgacgatttggaccagacatttgctgaa
cttactggatattaa

DBGET integrated database retrieval system