KEGG   Drosophila mojavensis: Dmoj_GI22929Help
Entry
Dmoj_GI22929      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein, isoform B
  KO
K10374  
tropomyosin 2
Organism
dmo  Drosophila mojavensis
Brite
Cytoskeleton proteins [BR:dmo04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     Dmoj_GI22929
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 284 aa AA seqDB search
MDAIKKKMQAMKLEKDNAIDKADTCENQAKDANSRADKLNEEVRDLEKKFVQVEVDLVTA
KEQLEKANTELEEKEKLLTATESEVATLNRKVQQIEEDLEKSEERSTTAQQKLLEATQSA
DENNRMCKVLENRSQQDEERMDQLTNQLKEARMLAEDADTKSDEVSRKLAFVEDELEVAE
DRVRSGESKIMELEEELKVVGNSLKSLEVSEEKANQRVEEFKREMKTLSIKLKEAEQRAE
QAEKQVKRLQKEVDRLEDELGINKDRYKSLADEMDSTFAELAGY
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggacgccatcaagaagaagatgcaagcgatgaagcttgagaaggataatgccattgat
aaggcagatacctgcgagaatcaagctaaggatgccaactcccgtgccgacaaactcaat
gaggaggtgcgcgacttggagaagaaatttgttcaggttgaggtcgatttggtcaccgcc
aaggagcagctggagaaggccaacaccgaattggaggagaaggagaaactgttgaccgcc
acggaatccgaggtagccaccttgaaccgtaaggtgcaacagattgaggaggatttggag
aaatctgaggagcgctcaaccaccgcacaacagaagctgttggaggccacacagtcggcc
gatgagaacaaccgtatgtgcaaagtattggagaaccgttcccagcaggatgaggagcgt
atggatcagttgaccaaccaattgaaggaagctcgcatgcttgctgaggatgccgatacc
aagtccgatgaggtctcccgcaagctggccttcgttgaagacgagctcgaagtggctgag
gatcgtgtccgctccggtgaatccaagatcatggagctggaggaagaactgaaggttgtc
ggcaactcgctgaaatctttggaagtgtccgaggagaaggccaaccagcgcgttgaggaa
ttcaagcgtgagatgaagaccttgtctatcaagttgaaggaggccgaacagcgcgccgaa
caggctgagaagcaagtcaagcgcctgcagaaggaagtcgacaggctagaagacgagctg
ggcatcaacaaggacaggtacaagtctctggccgacgagatggactccacattcgccgaa
ttggctggctactaa

DBGET integrated database retrieval system