KEGG   Drosophila mojavensis: Dmoj_GI23110Help
Entry
Dmoj_GI23110      CDS       T01062                                 

Definition
(RefSeq) GI23110 gene product from transcript GI23110-RD
  KO
K05858  
phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
dmo  Drosophila mojavensis
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Wnt signaling pathway
Phototransduction - fly
AGE-RAGE signaling pathway in diabetic complications
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Dmoj_GI23110
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Dmoj_GI23110
   04070 Phosphatidylinositol signaling system
    Dmoj_GI23110
 Organismal Systems
  Sensory system
   04745 Phototransduction - fly
    Dmoj_GI23110
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    Dmoj_GI23110
Enzymes [BR:dmo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     Dmoj_GI23110
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 1339 aa AA seqDB search
MMSAGGTYISTASVEVPKALQDGEKFIKWDDDSGSGTPVTMRVDAKGFFLYWVDQNNELD
ILDIATIRDVRTGQYAKKPKDAKLRQIVTMGPQDTLEEKTVTICHGSDFVNMTFVNFCCT
RRDIAQIWTDGLIKLAYSLAQLNGSAIMFLQKAHTKLCLQVDKSGRIPVKNIIKLFAQNK
EDRKRVEKALDVTGLPSGKVDSISVSKFQFEDFYNLYKYLTQRSEVERLFDSIVGNAKRK
CMSVAQLVEFLNKTQRDPRLNEILYPYANNARAKELIQQYEPNKFNAQKGHLSLDGFLRY
LMGDDNPIMAPNKLDLCDDMDQPMSHYFINSSHNTYLTGHQLTGKSSVEIYRQCLLAGCR
CVELDFWNGRTEEPVIVHGYTFVPEIYAKDVLEAIAESAFKTSEYPVILSFENHCNPRQQ
AKIANYCREIFGDMLLDKPLDSHPLEPNVDLPPPSALRRKIIIKNKKKHHHHHHHHHKKP
SSAMGQGTPAGGNKLTTANSVDAAAKAATAAAAAANAQQVAAAAQDEAGAGAGRTLTGAA
NGDIVSGAGGGHAPPLQQIRQSSKDSTGSSDSDSSSDDESLPNTTPSLPSGNEPPPDKAQ
KETEAGAEISALVNYVQPIHFSSFENAEKKNRCYEMSSFDEKQATTLLKERPIEFVNYNK
HQLSRVYPAGTRFDSSNFMPQLFWNAGCQLVALNFQTLDLAMQLNLGIFEYNARCGYLLK
PEFMRRSDRRLDPFAESTVDGIIAGTVSITVLSGQFLTDKRVNTFVEVDMYGLPADTVRK
KFRTKTVRDNGMNPFYDEEPFVFKKVVLPELASIRLAAYEEGGKLIGHRVLPVIGLCPGY
RHVNLRSEVGQPIGLASLFLCVVVKDYVPDDLSNFAEALANPIKYQSELEKRDIQLSVLT
DETDAVANADEDLSKSFVFVQVGGQKKELRPVESLATSPKHRASISIITSSSVEQPTDRP
DGGRNDDNVSIVTSGIQHQHSLDQSVSTSIRQVESSQFDVDLVIAEPLEKILEHKSVREK
RLEMEKKLESLRKKHDKEKLKIAGQKLSPLDGGKKPKFTITNKLVKRLSNKSLNCLSPYS
EPGVEVPPCPLDLGDSSEGSAGAGELGDEAASSSLEGTQESRLRYACREYTTQYRELQEK
YHEAIYSAAEKVLKNSQASQTKQLKASLDKVTGEVMHQLQEARRNEVKNLATVHRDRDEL
VRMKREVASSVVERGVAERMRLKQTFDKRTDELQKQHEAVRNALAEHRLKARQILDKDAE
SRCCVSNSGFLVLFHGPHHHGCSSGGAGSSAAASSLSAPSSGNNLTLNLDGRGAMGSGAA
GLAISPAKSHNSITAEMKT
NT seq 4020 nt NT seq  +upstreamnt  +downstreamnt
atgatgagcgcaggcggcacctacatatcgacggccagcgtggaggtgccaaaggctctg
caggatggcgagaagttcattaagtgggacgacgattcaggcagcgggacaccggtgaca
atgcgagtggatgccaagggcttctttctctattgggttgatcaaaacaatgagctcgac
attctggacattgccacaattcgtgatgtgcgcacaggacagtatgccaaaaagccaaaa
gacgccaagttgcggcagattgtgacgatggggccacaggacacactcgaggagaagacc
gtcaccatttgccatggctccgattttgtcaacatgacatttgtcaacttctgctgcaca
cgacgggacattgcccagatttggacggacgggctcatcaaattggcctacagtctggcc
cagctgaacggctcggcgattatgttcctgcagaaggcgcacacaaagctctgcctgcag
gtggacaaaagcggacgcatcccagtcaaaaacatcattaaactttttgcgcaaaataaa
gaggatcggaaacgtgtcgagaaggcgttggacgtgaccggtctgccgtcgggcaaggtc
gatagcatatcggtgtcgaaatttcaatttgaggacttttataatttgtacaaatatctg
acgcagcgctccgaggtggagcggctattcgatagcatcgtgggcaatgcgaagcgcaaa
tgcatgtccgtagcgcagctggtggagttccttaacaaaacgcaacgcgatccgcgcctc
aacgagattctctatccctatgcgaataatgcgcgcgccaaggagctcatccagcaatac
gagcccaacaagttcaacgcgcaaaagggccaccttagcttggatggctttttgagatat
ctgatgggcgatgataatcccataatggcgcccaacaagctcgatctctgcgatgatatg
gatcaaccgatgtcgcattacttcatcaactcctcgcacaacacctacctgacgggtcat
cagctgacgggcaagtcatctgtggagatatacaggcaatgcctgctcgccggctgcaga
tgcgttgagctggacttttggaacggacgcaccgaggagccggtaattgtgcacggctat
acgtttgtgcccgaaatctatgccaaggacgtgctggaggccatcgcggagagcgcattt
aaaacatccgaataccctgtgatattgagcttcgagaatcactgcaatcccaggcaacag
gcaaagattgcgaactattgccgtgagatctttggcgatatgctgttggataagccgctc
gattcgcatccgctggagccgaatgtggacttgccgccgccctctgcgctgcggcgcaag
atcatcatcaaaaacaagaagaagcatcatcaccatcatcatcatcatcacaagaagcca
tcgtcggcaatgggacagggcacaccagctggcggcaataaactaacgacggcgaactca
gttgatgccgctgccaaggccgcaacagcggcagcagccgctgccaatgctcaacaagtg
gctgccgctgcgcaggacgaggctggcgctggagccggacggacactgacaggcgccgca
aatggtgacattgtgagcggtgctggcggaggacatgcgccgccattgcaacaaatccgc
cagagctcaaaggatagcaccggctcctcggactcggacagctctagcgatgatgaatcc
ctgcccaacacaacgcccagtctgcccagcggcaatgagccgccgccggacaaggcccag
aaggagacggaagcaggtgccgagatctcagcgctggtgaactacgtgcagcccatacac
ttcagctcctttgagaatgccgagaagaagaaccgctgctacgagatgtcctcgttcgat
gagaagcaggcgacaactttgctgaaggagcgacccattgagtttgtcaactacaacaag
caccagttgtcccgggtgtatccggcgggcacgcgcttcgacagctccaacttcatgccg
cagctgttctggaacgctggctgccagctggtggcgctgaactttcagaccctggacctg
gccatgcagctgaatctgggcatcttcgagtacaacgcacgctgcggttatttgctgaag
ccggagttcatgcggcgctccgatcgccggctcgatccgttcgccgagagcaccgtcgat
ggcatcatcgctggcaccgtgtccatcaccgtgctctccggccagtttctgacggacaag
cgcgtgaacaccttcgtcgaggtggacatgtacggcctgccggcggacaccgtgcgcaag
aagttccgcaccaagacggtgcgcgacaacggcatgaatcccttctacgacgaggagccg
ttcgtcttcaagaaggtggtcctgccggagctggccagcatacggctcgctgcctacgag
gagggcggcaagctaattggccaccgggtgctgcccgtgattggcctctgtccgggctat
cggcatgtgaatctgcgctctgaggtgggccagcccattgggctcgcctcgctattcctg
tgcgtcgtcgtcaaggactatgtgcccgacgatctgtccaatttcgccgaggctctggcc
aatcccatcaagtaccagagcgagctggagaagcgcgacattcagctctcggtgctgaca
gatgagacggatgcggtggccaatgccgacgaggatctgtccaagtcattcgttttcgtc
caagtaggtggccaaaaaaaggaactgcgtccagttgagtcgctagccacctcgcccaag
catcgggcgagcatatccataataacctccagcagcgtggagcagccgacggatcggccc
gacggtggacgcaacgatgacaatgtctcgattgtgacatcgggcatacagcatcagcac
tcgctggaccagtcggtgagcacgtccatcaggcaggtggagtcctcacagttcgatgtg
gacctggtgatagccgagccgctggagaagatactcgagcacaagtcggtgcgcgagaag
cggctggagatggagaagaagctggagtcgttgcgcaaaaagcacgacaaggagaaactg
aagatcgccggccagaagctcagccccctcgacgggggcaagaagcccaagttcaccatc
accaacaagctggtgaagcgtctcagcaacaagagccttaattgcctctctccgtacagt
gagccgggcgtcgaggtgccgccgtgcccgctcgatctgggcgacagcagcgagggaagc
gccggcgccggggagctgggcgacgaggccgcctccagcagcctggagggcacacaggag
tcgcgtctgcgctacgcctgccgcgagtacaccacacagtatcgcgagctgcaggagaag
tatcacgaggccatctactcggccgccgagaaggtgctgaagaactcgcaggccagccaa
accaaacagctgaaggcctccctcgacaaggtcaccggcgaggtgatgcaccagctgcag
gaagcgcgacgcaatgaggtcaagaatctggccacggtgcacagagatcgcgatgagctg
gtcagaatgaagcgagaggtggccagctctgtggtggagcgcggcgtggctgagcgcatg
cggctcaagcaaacattcgacaagcgcacggatgagctgcagaagcagcacgaggcggtg
cgcaatgctctagccgagcatcggctgaaggcacgtcaaatactcgacaaggatgcagaa
tctcgttgctgcgtctcgaacagtggcttcctggtgctcttccatggaccgcatcatcac
ggctgctcgtccggcggagcgggatcaagcgccgctgctagcagtctgtcggcgcccagc
tctggcaataatctcacattgaatttggatggcaggggagcgatgggcagtggagccgct
ggactggccatatcgccggccaagtcgcacaacagcattacggcggagatgaagacataa

DBGET integrated database retrieval system