KEGG   Drosophila mojavensis: Dmoj_GI23147Help
Entry
Dmoj_GI23147      CDS       T01062                                 

Definition
GI23147 gene product from transcript GI23147-RA
Orthology
K04437  
filamin
Organism
dmo  Drosophila mojavensis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1450 aa AA seqDB search
MIDTRGAGQGGLGVTVEGPCEAAINCRDNGDGTCNVAYLPTEAGDYTVNITFNERHINGS
PFQPIIAPVPNLKNTRVSGIGIQPHGVIMNADTDFMVDMSKVGSNIESGKLSCAIFDPMG
HVLPNKMVQGPTDDIFRIMYSPFEAGRHTIELMYDNIPVPGSPFVVNVKSGCDPTRCKAY
GPGLEKGLTNQKNKFTVETKGAGKGGLSLAIEGPSEAKMTCTDNRDGSCDVDYLATDPGE
YDITIRFADKHIPGSPFRVLVEETVDPSKVKVYGPGIEHGQVRESVPTVFNVDVGEAGPG
RIAVKLTNSEGIPVDNLSVEDKGNCIYAVHYVPPKAGSVLTCQVKFADEEVPCSPFVMTV
FPKSEATKVTVKGVNEKKKTPASLPAEFEIDTKQAGQADINVAIKNPKGKRMQPRLEEVA
TGTYVVSFVPDECGTYQCSIKYGDKEIEGSPFKLEAFPTGEAKKCKLVEEAPKIQPSGSQ
SHLKVDAREAGNGAVTCKITNKEGSEIVDIDVIEKDGFFDILYGLNDPGDYDINVKFGGK
DIPNGSFSIKAVESVEQYSHSEYIEEHTTKVVKQTTTQSELVNGKSEVTYRAVAFEKLPL
PTTGGNVTAEVRMPSGKVDKPIIQDNRDGTVSVKYDPREEGSHELVVKYNGEPVQGSPFK
FHVDSITSGYVTAYGPGLTHGVTGEPANFTISTKGASAGGLTMAVEGPSKADIKYHDNKD
GTVSVQYLPTAPGEYQVSVRFGDKHIKGSPYFAKITGEGRKRNQISVGSCSEVTMPGDIT
DDDLRALNASIQAPSGLEEPCFLKRMPTGNIGISFTPREIGEHMVSVKRLGKHINNSPFK
VTVCEREVGDAKKVKVSGNGLKEGQTHSDNIFSVDTRNAGFGGLSVSIEGPSKAEIQCTD
KDDGTLNISYKPTEPGYYIVNLKFADHHVEGSPFTVKVAGEGSNRKREKIQRERDAVPIT
EIGSQCKLTFKMPGITSFDLAACVTSPSNVTEDAEIQEIEDGLYSVHFVPKELGVHTVSV
RYSEMHIPGSPFQFTVGPLRDSGSHLVKAGGSGLERGVVGEAAEFNVWTREAGGGSLAIS
VEGPSKADIEFKDRKDGSCDVSYKVTEPGEYRVGLKFNDRHIPDSPFKVYISPDAGDAHK
LEVQQFPQGNIQADAPYQFMVRKNGAKGELDAKIVAPSGTDDDCFIQVIDGDMYSVRFYP
RENGIHAIHVKFNGVHIPDSPFRIKVGKDVADPAAVHATGSGLDEVKTGHKADFIINTCN
AGVGTLAVSIDGPSKVAMDCTEVEEGYKVRYTPLLPGEHYITVKYNNMHIVGSPFKVHAT
GERLADEGAQETSTVIVETVQKVAKGGKNTGVHLPTFKSDASKVVSKGMGLKKAYIGKQN
QFSVCATDAGNNILYVGMYGPKGPCEEFHVKHAGHNNYNVQYLVRDRGQYVLLIKWGEDH
IPGSPFQIDV
NT seq 4353 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatacccggggagcgggccaaggcggcctgggcgtcaccgtcgaggggccctgc
gaggcggccataaattgccgggacaatggcgacgggacctgcaatgtagcctacctgccc
accgaggcgggcgactacactgtcaacataacgttcaacgagcgccacatcaatggctct
ccattccagccgataattgcgcctgtgccgaatctgaagaatacgcgagtgagcggcatc
ggcatacagccgcatggtgtcatcatgaatgccgacacggactttatggtcgacatgagc
aaggtgggcagcaacatcgagtctggcaagctttcgtgcgccatcttcgacccgatgggt
catgtactgcccaacaagatggtgcagggtcccaccgacgacatcttccgcatcatgtac
tcgcccttcgaggcgggccgtcacacgattgagctgatgtatgataatatacccgtgccg
ggctcgcctttcgtggtgaacgtgaaaagcggttgcgatccgacgcgttgcaaggcctac
ggcccgggtttggagaaaggcttgacaaatcagaagaataagttcaccgtggagactaag
ggcgccggcaagggcggcctatcgctggctatcgaaggaccctccgaggccaagatgacc
tgcacggacaatcgcgatggcagctgcgatgtcgactatctggccacggatccgggcgag
tatgatataaccatacgctttgcggataagcacatacccggctctccgttccgtgtgctc
gtcgaggagactgttgatcccagcaaggtgaaggtctacggaccgggcatcgagcacggc
caggtgcgcgagagtgtgccaacggtgttcaatgtggatgtaggcgaggctggtcctggc
cgcattgctgtcaagctgaccaactccgagggcatacccgttgacaatctgagtgtcgag
gacaagggcaattgcatttatgcggttcactatgtgccgcccaaggccggttccgtgctc
acctgccaggtgaagtttgccgacgaagaagtgccatgcagtccgtttgtgatgaccgtt
ttccccaagtccgaggcgaccaaggtcacggtgaagggcgtcaacgaaaagaagaagacg
cccgcctcattgcccgccgaattcgagattgatacgaagcaagccggccaggcggacatc
aatgtggccatcaagaatcccaagggcaagcgcatgcagccacgcctagaggaggtcgcc
actggcacctatgtggtctcctttgtgcccgatgagtgcgggacgtatcaatgcagcatc
aagtacggcgacaaggagatcgaaggctcgcccttcaaactcgaagcattccccaccggc
gaggccaagaaatgtaagcttgtcgaggaggcgcccaagatacagccatccggtagtcag
tcgcatctgaaggtggatgcacgcgaggcgggcaatggtgctgtcacatgcaagataacc
aataaggaaggcagtgaaatcgtagacattgatgttatcgagaaggatggcttctttgac
atactgtatggcctgaacgatcccggagactacgatatcaatgtcaagttcggaggcaag
gatatacccaatggcagcttctccattaaggctgtcgaaagcgtcgaacaatactcgcac
agtgagtacatcgaggagcatacgaccaaagtggttaagcagacaacaacacagagcgaa
ctggttaacggaaaatcagaagtaacatatcgagctgttgcctttgagaaattgccacta
cccacaacaggcggaaacgtaactgctgaagtcagaatgccaagtggtaaggtagataaa
cccattattcaggataaccgtgatggtacggtctccgtgaagtacgatcctcgtgaggag
ggctcccatgagctggttgttaaatacaatggcgagcctgttcaaggatctccattcaaa
ttccatgtggactccataacatccggatatgtgaccgcttatggaccaggcctgacgcac
ggtgtcaccggtgaacccgcaaactttaccatctccaccaagggcgccagcgctggcggt
ctaaccatggccgtcgagggacccagcaaggcagacatcaaatatcatgacaataaagac
ggcactgtttcggtgcaatatctgcccacggctccaggtgaataccaggtgtcggtgcgc
ttcggcgacaagcacatcaagggctcgccctactttgccaagataactggtgagggtcgc
aaacgtaaccagatttcggttggctcctgctcggaggtgactatgcccggcgacatcacc
gacgatgatctgcgcgctttgaacgcctccatccaggcgcccagcggcttggaggagccc
tgcttcctcaagcgcatgcccaccggcaacattggcatttcgttcacgccccgtgagatt
ggcgaacatatggtgtcggtgaagcggctgggcaagcacatcaacaactcgcccttcaag
gtgaccgtgtgcgagcgcgaagtgggcgacgccaagaaagtcaaagtcagcggcaacggc
cttaaggagggacagacgcacagcgacaatattttctccgtggacactcgcaacgccggc
ttcggtggtctctcggtgtccattgagggtcctagcaaggcggagattcagtgcaccgac
aaggatgacggcacactgaacatctcctataagcctacggagcccggctactacattgtc
aatctgaagtttgccgatcatcacgtcgaaggctcacccttcaccgtgaaggtggccggc
gagggcagcaatcgcaagcgcgagaagattcaacgtgagcgcgacgcagtgcccatcact
gaaattggcagccagtgcaagctgaccttcaagatgcccggcatcacatccttcgatctg
gccgcctgcgttacatcgcccagcaatgtcaccgaggacgccgagatccaggagatcgag
gatggtctgtactcggtgcactttgtgcccaaggaactgggagtgcacaccgtctcggtg
cgctactctgagatgcacatccccggctcgcccttccagtttacagtgggtccactgcgc
gactcgggcagccacttggtgaaggctggcggctctggcttggagcgcggcgttgtcggc
gaggcagccgagttcaatgtgtggacacgtgaggctggtggcggctctctggctatctca
gtggagggtcccagcaaggccgacattgagttcaaggatcgcaaggacggcagctgcgat
gtctcctataaggtgaccgagcctggcgagtatcgtgtgggcctcaagttcaacgaccgc
cacatcccagactcgcccttcaaggtgtacatctctcccgatgccggcgacgcccacaag
ctggaggtacagcagttcccacagggcaacatccaggccgacgcaccctatcagtttatg
gtgcgcaagaacggcgccaagggtgagctggatgccaagattgtggctccatctggcacc
gatgacgattgctttatccaggtgatcgacggtgatatgtactcggtgcgcttctatcca
cgtgagaacggcatccacgccatccacgtcaagttcaatggcgtgcacatacccgactcg
ccattcagaatcaaggtgggcaaggatgtggccgatccggcagctgtgcatgccaccggc
agcggcttggacgaagtgaagactggacacaaggccgatttcatcatcaacacgtgcaat
gcgggcgttggcacactggccgtctccatcgatggtccatccaaggtggccatggattgc
acggaggttgaggagggctacaaggtgcgctacacaccactgctgcccggcgagcactac
atcacggtcaaatacaacaacatgcatatcgtgggctcacccttcaaggtgcacgccacc
ggcgaaaggctggccgacgagggcgcccaggagacatccacagtgattgtggagaccgtc
cagaaggtggccaaaggcggcaagaacactggcgtccacctgcccaccttcaagtccgac
gccagcaaggttgtgtccaagggcatgggcctcaagaaggcctacattggcaagcagaac
cagttcagcgtctgtgccacagatgcgggcaataacatcctgtacgtgggcatgtacgga
ccaaagggtccgtgcgaggagttccatgtcaagcacgctggccacaacaactacaatgtg
cagtatctggtgcgcgatcgcggccaatacgtgctcctaatcaaatggggcgaagaccat
atacccggctccccattccagatcgatgtctag

DBGET integrated database retrieval system