KEGG   Drosophila mojavensis: Dmoj_GI23148Help
Entry
Dmoj_GI23148      CDS       T01062                                 

Definition
GI23148 gene product from transcript GI23148-RA
Orthology
K04437  
filamin
Organism
dmo  Drosophila mojavensis
Brite
Exosome [BR:dmo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dmoj_GI23148
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1078 aa AA seqDB search
MYSDQQLVLVNGGTLNSNDAIGDERQRNTATVHNNRSQQQRQHQHQQQQQKQQQQKIGSV
APVAELVQNVNYTNVNGQTQTQATIFLNHNNYRKIPPNLQNNVAAVAACAYNNCNNNTNN
SNNNNNSFSNLSFYAQQPTSNYNNNNELFQPNEYYQQQQSEQYEENFDEDMEAERDLAED
AQWKKIQQNTFTRWANEHLKTIDRSINNLETDLSDGLRLIALIEVLSQKRLPKHNKRPTF
RSQKLENVSVSLKFLQDEGIKIVNIDSSDIVDCKLKLILGLIWTLILHYSISMPMWDGED
EKQLNGSGQTPKQRLLNWIHARIPDMPINNFTNDWTTGKAVGALVDACAPGLCPDWEMWD
PKDAVQNASEAMGLADDWLNVRQLIKPEELVNPNVDEQSMMTYLSQYPNAKLKSGAPLRP
KTNPNRVRAYGPGIEPIGPVVGAPANFTVETFSAGKGIVDVEIEGPDGVVEKADVRFNND
KNLTYTISYIPKAEGLHKVAVKYSGRDIPKSPFPVKVEGHAGDASKVKVTGPGIQPTGVT
IKKPTFFDILTKDAGRGVPEVIIIDPANHKTSVAAKVRQLENDTWRCEYVTALQGLHSVN
VFYAGTPIPNSPFPVKVAPLSDARKVRVSGRGLQATGVRVGDDADFKIHTEGAGEGVPEV
RVIGPGGMNQNVMQSKVDGNTYECHYYPTKEGRYVVMVTFSGQEVPKSPFEVKVGPKKES
SIVAYGPGLSSGVIGYPAAFVVETNGETGALGFTVAGPSQAEIECHDNGDGSALVKYHPT
AVGEYAVHILCDNEDIPKSPFIAHILPRTDFHPELVKAIGPGLEKNGVTINETATFDVDT
SKAGNAPLDIVVQDVYGNKLPVQVKSNPDGTKKVSYTPNSGVPHTVEVNYGGVSTPNSPH
RVYVGVPVDATKVQAFGPWLQPGVRPNMPTHFNVDARDAGDAELKVKIVHEDTKLEVPCR
IIDNQDNTYSVEVIPPMKGAYTTTMTYGGQRVPLGQKVVVEQTVDVSKIKVDGLEPSGSG
CDHNESVGQSGEGAHHTHSRRFSGQLHAHAAGRVFAQHLLWRHTHHATPLSSTMPHGQ
NT seq 3237 nt NT seq  +upstreamnt  +downstreamnt
atgtacagcgatcagcagttggtgttagttaacggcggtacgctcaacagtaacgacgct
attggcgacgagcggcaaagaaacacagcgacagttcacaacaatcgaagccagcagcaa
cgccagcaccaacaccagcaacagcaacaaaaacaacaacagcagaagatcggttcggtg
gcccctgttgctgaattagtgcaaaacgtgaattatacaaacgtcaacggtcaaacgcag
acgcaggcgacaatatttctaaatcacaataattatagaaagatcccgccgaatttgcag
aacaacgtcgctgcagtcgccgcgtgtgcttacaacaattgcaacaacaacaccaacaac
agtaacaacaacaacaacagttttagcaatttaagtttttacgcccagcagccaacgagc
aactacaacaacaataacgagctctttcaaccgaacgaatattaccaacagcagcagtcg
gaacagtacgaggagaacttcgacgaagatatggaggccgaacgggatctagccgaggat
gcccaatggaagaaaatccaacagaacaccttcacacgctgggccaacgagcatctgaaa
acgatcgatcgttcgataaacaatctggaaacggatctgtccgacggcctccgtctgatt
gcgctcatcgaggtgctatcccagaagcgtttgcccaagcataacaaacgtcccacattc
cgtagccagaaactggagaatgtatcggtttccctgaaattccttcaggatgagggcatc
aaaattgttaacattgattcttcggatattgttgactgcaaactgaaactgatattgggt
cttatatggacgctcattctgcactactcgatatcgatgcccatgtgggatggcgaggat
gagaagcagttgaatggctctggacagacgcccaagcagcgcttgttgaactggatacac
gcccggatacctgatatgcccatcaataacttcaccaacgactggaccacaggcaaggcg
gtgggcgcattggtggatgcctgcgcgcccggcttgtgccccgattgggagatgtgggat
cccaaggacgcggtgcagaacgcatcggaagctatgggtctggccgatgactggctgaat
gtgcgtcaactgatcaagccggaggagttggtcaatcccaatgtggatgagcagtctatg
atgacatacttgtcgcagtatcccaacgccaagctgaagtcaggtgctccattgcgtccc
aagacgaaccccaatagagtgcgtgcctatggacccggcattgagcccattggccccgta
gttggtgcgcctgctaacttcactgtggaaactttcagcgcaggcaaaggtattgttgat
gttgaaattgaaggacccgatggcgtggtagagaaggccgatgtacgcttcaacaatgac
aagaatctcacctacaccatttcttatatacccaaggctgagggtctgcacaaagtggcc
gtgaagtattcgggccgtgatatacccaagtcgccgttccccgttaaggtcgagggtcat
gccggcgacgcctcgaaggtgaaggtaactggccccggcatccagcccacgggagtgacc
atcaagaagccgacgttctttgatattctcaccaaggatgcgggtcgcggtgtgcccgag
gtgatcattattgatccggccaaccacaagacgtcggtggccgccaaggtgcgccagttg
gagaatgatacttggcgctgcgaatatgtcaccgcactgcagggtctgcactcggttaat
gtattttatgcgggcacgcccataccaaacagcccgttccccgtgaaggtggctccgttg
tcagatgcgcgcaaagtgcgcgtctccggccgtgggctgcaggcgacgggcgtgcgtgtg
ggcgacgatgcggacttcaaaatacataccgagggtgccggtgagggtgtgccagaggtg
cgcgtcattggacctggcggcatgaaccagaacgtcatgcagtccaaggtggatggcaat
acgtatgagtgccattactatccaaccaaggagggtcgctatgtagtcatggttacgttt
agcggacaggaagtgcccaagtcgccgttcgaggtgaaggtgggaccgaagaaggagtct
tcgattgtggcctacgggccgggcttaagcagcggtgtcattggctaccccgccgccttt
gtcgtggagaccaatggcgaaacgggcgcactcggcttcaccgtggccggaccctcacaa
gcagagattgagtgccatgacaatggtgatggctccgcattggtcaagtatcatccaact
gccgtgggcgagtatgctgtgcacatactctgcgacaacgaggacatacccaagtctccg
ttcatagcacacatactgccgcgcaccgacttccatccggaactggtcaaggccatcgga
ccgggtctggagaagaacggcgtgaccatcaatgagacagccaccttcgatgtggatacc
agcaaggcgggtaatgcgccgctcgacattgtcgtccaggatgtttacggcaacaagctg
ccagtgcaggtcaagagtaatcccgatggcaccaagaaggtcagctatacacccaactcc
ggcgtgccgcatactgtagaggttaactatggtggtgtctccacgcccaattcgccgcat
cgcgtctatgtgggcgtgcctgtggatgcgacaaaggttcaagcctttggaccctggttg
caaccgggcgttcggcccaatatgcccactcacttcaatgtggatgcacgcgatgctggc
gacgcggagctgaaggtgaaaatcgtacacgaggacaccaagttggaggtgccttgtcgc
atcatcgacaaccaggacaacacatactccgtagaggtcattccacccatgaaaggcgcc
tacaccactaccatgacgtacggcggacagcgtgtgccgttgggccaaaaggtggtcgtc
gagcagacggtggatgtgtccaagatcaaggtggacggcctggagcccagcggatctggc
tgtgaccataacgagtccgtcgggcaatcgggtgaaggcgcacatcatacccacagccga
aggttttctggtcaacttcacgcccacgcagctgggcgagtatttgctcagcatttgctt
tggcggcacacccatcacgccacgcccctttcgtctacaatgcctcacgggcagtga

DBGET integrated database retrieval system