KEGG   Drosophila mojavensis: Dmoj_GI23383Help
Entry
Dmoj_GI23383      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dmo  Drosophila mojavensis
Pathway
dmo00010  Glycolysis / Gluconeogenesis
dmo00051  Fructose and mannose metabolism
dmo00562  Inositol phosphate metabolism
dmo01100  Metabolic pathways
dmo01200  Carbon metabolism
dmo01230  Biosynthesis of amino acids
Module
dmo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
dmo_M00002  Glycolysis, core module involving three-carbon compounds
dmo_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dmoj_GI23383
   00051 Fructose and mannose metabolism
    Dmoj_GI23383
   00562 Inositol phosphate metabolism
    Dmoj_GI23383
Enzymes [BR:dmo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Dmoj_GI23383
Exosome [BR:dmo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Dmoj_GI23383
  Exosomal proteins of bladder cancer cells
   Dmoj_GI23383
  Exosomal proteins of melanoma cells
   Dmoj_GI23383
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 6572782
NCBI-ProteinID: XP_001998888
FlyBase: FBgn0146109
UniProt: B4K815
Position
Unknown
AA seq 346 aa AA seqDB search
MFLIYNNGLYRLQPKQFIQSKTVDSHCASRGIFFSNPSIMDMNHSATNLTLDALKSVVSQ
ALLGKFTAVFPKLFKCQWKTYEGQKKLYANFSKDTVSNMSGRKFCVGGNWKMNGDQKSIA
EICKVLSDAQLDPNTDVVIGCPAIYLMFARNLLPCSIGVAGQNAYKVAKGAFTGEISPAM
LKDVGADWVILGHSERRAIFKESDELIAEKAEHALAEGLKVIACIGETLEEREAGRTNEV
VARQMCAYAKKIRDWTNVVVAYEPVWAIGTGKTATPDQAQEVHAFLRQWLTENISKEVSN
TLRIQYGGSVTAANAKELAKKPDIDGFLVGGASLKPEFVDIVNARK
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgtttttgatttacaataacggattataccgcctccagcccaagcagtttattcaaagc
aaaacagtagattctcattgcgcgtccaggggtatattcttttcgaacccatccatcatg
gacatgaaccattcggcgaccaatttaacgctggacgcacttaagagcgtcgtctcgcaa
gctcttctgggcaaattcacagctgtttttccaaagcttttcaagtgccaatggaagaca
tatgaaggtcagaagaagctctacgcgaacttctccaaagacaccgtcagcaacatgagt
ggccgtaaattctgcgtgggtggcaactggaagatgaacggcgaccagaagtcgattgcc
gaaatctgcaaagtactctccgatgcccagctcgatcccaacaccgatgtggtcattggt
tgcccggccatctatctgatgttcgcccgcaatctgctgccctgcagcatcggcgtggcc
ggccagaatgcctacaaggtggccaagggcgccttcactggtgagatttcgccggctatg
ctgaaggatgtcggcgctgattgggttatcttgggtcactcggagcgtcgcgccatcttc
aaggagtcggacgagctgattgccgagaaggccgagcacgccctggccgagggcctgaag
gtgattgcctgcattggcgagaccctggaagagcgtgaggctggcaggaccaacgaagtg
gtcgcacgccagatgtgcgcctatgccaagaagatcagggactggaccaacgtagtcgtt
gcctacgagcccgtttgggccattggaaccggcaagacagctacgcccgatcaggcccaa
gaggtgcacgccttcctgagacagtggctgacagagaacatctcgaaggaggtgtccaac
actctgcgcattcagtacggcggctctgtgacggccgccaatgccaaggagctggccaag
aagcccgacatcgatggtttcctcgttggcggcgcctccctcaagccagagttcgtggac
attgtgaatgcccgcaagtaa

DBGET integrated database retrieval system