KEGG   Drosophila mojavensis: Dmoj_GI23383Help
Entry
Dmoj_GI23383      CDS       T01062                                 

Definition
GI23383 gene product from transcript GI23383-RA
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dmo  Drosophila mojavensis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dmoj_GI23383
   01230 Biosynthesis of amino acids
    Dmoj_GI23383
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dmoj_GI23383
   00051 Fructose and mannose metabolism
    Dmoj_GI23383
   00562 Inositol phosphate metabolism
    Dmoj_GI23383
Enzymes [BR:dmo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Dmoj_GI23383
Exosome [BR:dmo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Dmoj_GI23383
  Exosomal proteins of bladder cancer cells
   Dmoj_GI23383
  Exosomal proteins of melanoma cells
   Dmoj_GI23383
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 307 aa AA seqDB search
MDMNHSATNLTLDALKSVVSQALLGKFTAVFPKLFKCQWKTYEGQKKLYANFSKDTVSNM
SGRKFCVGGNWKMNGDQKSIAEICKVLSDAQLDPNTDVVIGCPAIYLMFARNLLPCSIGV
AGQNAYKVAKGAFTGEISPAMLKDVGADWVILGHSERRAIFKESDELIAEKAEHALAEGL
KVIACIGETLEEREAGRTNEVVARQMCAYAKKIRDWTNVVVAYEPVWAIGTGKTATPDQA
QEVHAFLRQWLTENISKEVSNTLRIQYGGSVTAANAKELAKKPDIDGFLVGGASLKPEFV
DIVNARK
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggacatgaaccattcggcgaccaatttaacgctggacgcacttaagagcgtcgtctcg
caagctcttctgggcaaattcacagctgtttttccaaagcttttcaagtgccaatggaag
acatatgaaggtcagaagaagctctacgcgaacttctccaaagacaccgtcagcaacatg
agtggccgtaaattctgcgtgggtggcaactggaagatgaacggcgaccagaagtcgatt
gccgaaatctgcaaagtactctccgatgcccagctcgatcccaacaccgatgtggtcatt
ggttgcccggccatctatctgatgttcgcccgcaatctgctgccctgcagcatcggcgtg
gccggccagaatgcctacaaggtggccaagggcgccttcactggtgagatttcgccggct
atgctgaaggatgtcggcgctgattgggttatcttgggtcactcggagcgtcgcgccatc
ttcaaggagtcggacgagctgattgccgagaaggccgagcacgccctggccgagggcctg
aaggtgattgcctgcattggcgagaccctggaagagcgtgaggctggcaggaccaacgaa
gtggtcgcacgccagatgtgcgcctatgccaagaagatcagggactggaccaacgtagtc
gttgcctacgagcccgtttgggccattggaaccggcaagacagctacgcccgatcaggcc
caagaggtgcacgccttcctgagacagtggctgacagagaacatctcgaaggaggtgtcc
aacactctgcgcattcagtacggcggctctgtgacggccgccaatgccaaggagctggcc
aagaagcccgacatcgatggtttcctcgttggcggcgcctccctcaagccagagttcgtg
gacattgtgaatgcccgcaagtaa

DBGET integrated database retrieval system