KEGG   Drosophila mojavensis: Dmoj_GI23409Help
Entry
Dmoj_GI23409      CDS       T01062                                 

Definition
GI23409 gene product from transcript GI23409-RA
Orthology
K01230  
mannosyl-oligosaccharide alpha-1,2-mannosidase [EC:3.2.1.113]
Organism
dmo  Drosophila mojavensis
Pathway
N-Glycan biosynthesis
Metabolic pathways
Protein processing in endoplasmic reticulum
Module
N-glycan precursor trimming
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    Dmoj_GI23409
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Dmoj_GI23409
Enzymes [BR:dmo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.113  mannosyl-oligosaccharide 1,2-alpha-mannosidase
     Dmoj_GI23409
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 676 aa AA seqDB search
MTNTDHVALTLSSTSVTSLSGGAAGDESNISRRSLRRSWNQLPRCQRNLIIMAVTAFIFT
ALLFLPGDQLINIKDVRLKPGAAPFHIRRENTLQNPHHHPNVDKDNELPDDISAAVASPM
TDENRLIKAKAAEEKLDDSKFSENVDKLPETVVVGNENGIIDIVNNVDQPIEQPLENNIN
DPSNLRAEVEEAIRNPFRVSHVSIESHLQSISAQLAKPQHFHGATNERQSAVVAAFKHSW
AGYKTYAWGHDNLKPVSQTAHEWFGLGLSIVDSLDTMYIMGLEDEFNEARNWVKDALHFH
TNRDVNLFEVTIRVLGGLLSAYHLSGDRMFLVKATELGNRLLPSFLSPSGIPYSDVNLGE
RSAHSPKWSPDSSTSEVTTIQLEFRDLSRSTNVSIYERVVNVVNEKVHALDKSHGLVPIF
INANTGTFRNYATISLGARGDSYYEYLLKQWLQTGRKDNDNLILDYMQAIDGVFTQLMRR
TPREHWVYIGELINGHDFKPKMDHLTCYLPGTLLLGHQNGMPESHLLLAKDLLDTCYQTY
VRQPTQLAAEISYFALTDKEENDIYVKSNDAHNLLRPEFIESLYYFYALTGNRTYQDMGW
VIFQAFEKHSKVAAGYTSLGNVKNTLNTRMRDLMESFWLSETLKYFYLLFSDNCREIDLD
KWVFNSEGHPLPVYQN
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atgacaaacaccgaccacgttgccctcactctatcgtcgacatccgtgacgagcctatca
ggcggagctgccggcgatgaaagtaatatatcccgaaggagcttgcgtcggtcatggaat
cagttacccagatgtcaacgtaatctcatcataatggccgtcacagcatttatatttact
gctctactatttttgccgggcgatcagctaattaacataaaggatgtgcgtctgaaaccc
ggagcggcgcctttccatatacggcgcgaaaatacgctacaaaatccgcatcatcatccg
aacgttgataaggataacgagctacctgacgatatttccgcagctgtcgcatccccaatg
actgatgagaaccgcctaattaaagcgaaggcggccgaagaaaagttggatgacagtaaa
ttttctgaaaacgttgataagctaccggaaactgtggttgttggcaatgaaaatgggata
atcgacatagtcaacaatgtggatcagcccatcgaacagcccttggaaaataatatcaat
gacccctcgaatttacgtgcagaagtggaggaggctattcgcaacccattcagagtatcc
catgtcagcattgagtctcatcttcagagtataagcgcacagttagcaaaaccccagcat
ttccatggcgctaccaatgagcggcagtctgcagttgtggcagcctttaagcactcgtgg
gctggttataagacttatgcctggggtcacgacaatctaaaacccgtttcccaaactgca
cacgaatggtttggtctaggactgtcaatcgttgattctctggacacaatgtatatcatg
ggcctagaagatgagttcaacgaggcacgcaattgggtcaaagatgctttgcatttccac
acaaatcgcgacgttaatctcttcgaggtaaccatacgtgtgctgggcggtttgctgtcc
gcttaccatttgagcggcgataggatgtttttggttaaagccactgagcttggcaatcgc
ttactgcccagttttctttcgccgtcgggcattccatattcagatgtgaatctgggcgaa
agatctgcacattcgccaaaatggtctccagatagttcaaccagcgaagtaacgactata
cagttggaattccgtgatctgagtcgctctacaaatgtttctatctatgagcgggtggta
aacgtagtgaatgaaaaagtacacgcactagataaaagtcacggcctggtgccaatattt
atcaatgccaacacgggcacctttagaaattatgcgacaatctcattgggtgcacgtggc
gactcgtactatgagtacttactcaagcaatggctgcaaacgggtcgcaaggataacgac
aatcttattttggactacatgcaagcgatagacggcgtattcacgcaattgatgcgacgc
acaccgcgcgaacactgggtatatataggggagctaattaatggtcatgactttaagccc
aaaatggatcatttgacatgctacttgcctggtactttattgcttggccaccagaatggc
atgcccgaatcgcatctactgctcgctaaggatttgttggacacgtgttatcaaacctat
gtcagacagcctactcaattggcagctgagatatcatactttgcgctgaccgacaaggaa
gagaatgatatatatgtgaagtcgaatgatgcgcacaacttgctgcgacccgagttcata
gaaagcttgtattacttttatgcactaaccgggaaccgcacatatcaggatatgggctgg
gtcattttccaggcattcgaaaagcattcaaaagtagctgcaggctacacatcactgggc
aatgtgaaaaacactttgaatactcgaatgcgcgatctcatggaaagcttctggttgagc
gagactttgaaatatttctatttgctatttagtgacaattgcagggaaatagacctcgac
aagtgggtcttcaactcggagggtcatccgctgcccgtgtaccagaactaa

DBGET integrated database retrieval system