KEGG   Drosophila mojavensis: Dmoj_GI23409Help
Entry
Dmoj_GI23409      CDS       T01062                                 

Definition
GI23409 gene product from transcript GI23409-RA
Orthology
K01230  
mannosyl-oligosaccharide alpha-1,2-mannosidase [EC:3.2.1.113]
Organism
dmo  Drosophila mojavensis
Pathway
N-Glycan biosynthesis
Metabolic pathways
Protein processing in endoplasmic reticulum
Module
N-glycan precursor trimming
Class
Metabolism; Glycan biosynthesis and metabolism; N-Glycan biosynthesis [PATH:dmo00510]
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:dmo04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 676 aa AA seqDB search
MTNTDHVALTLSSTSVTSLSGGAAGDESNISRRSLRRSWNQLPRCQRNLIIMAVTAFIFT
ALLFLPGDQLINIKDVRLKPGAAPFHIRRENTLQNPHHHPNVDKDNELPDDISAAVASPM
TDENRLIKAKAAEEKLDDSKFSENVDKLPETVVVGNENGIIDIVNNVDQPIEQPLENNIN
DPSNLRAEVEEAIRNPFRVSHVSIESHLQSISAQLAKPQHFHGATNERQSAVVAAFKHSW
AGYKTYAWGHDNLKPVSQTAHEWFGLGLSIVDSLDTMYIMGLEDEFNEARNWVKDALHFH
TNRDVNLFEVTIRVLGGLLSAYHLSGDRMFLVKATELGNRLLPSFLSPSGIPYSDVNLGE
RSAHSPKWSPDSSTSEVTTIQLEFRDLSRSTNVSIYERVVNVVNEKVHALDKSHGLVPIF
INANTGTFRNYATISLGARGDSYYEYLLKQWLQTGRKDNDNLILDYMQAIDGVFTQLMRR
TPREHWVYIGELINGHDFKPKMDHLTCYLPGTLLLGHQNGMPESHLLLAKDLLDTCYQTY
VRQPTQLAAEISYFALTDKEENDIYVKSNDAHNLLRPEFIESLYYFYALTGNRTYQDMGW
VIFQAFEKHSKVAAGYTSLGNVKNTLNTRMRDLMESFWLSETLKYFYLLFSDNCREIDLD
KWVFNSEGHPLPVYQN
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atgacaaacaccgaccacgttgccctcactctatcgtcgacatccgtgacgagcctatca
ggcggagctgccggcgatgaaagtaatatatcccgaaggagcttgcgtcggtcatggaat
cagttacccagatgtcaacgtaatctcatcataatggccgtcacagcatttatatttact
gctctactatttttgccgggcgatcagctaattaacataaaggatgtgcgtctgaaaccc
ggagcggcgcctttccatatacggcgcgaaaatacgctacaaaatccgcatcatcatccg
aacgttgataaggataacgagctacctgacgatatttccgcagctgtcgcatccccaatg
actgatgagaaccgcctaattaaagcgaaggcggccgaagaaaagttggatgacagtaaa
ttttctgaaaacgttgataagctaccggaaactgtggttgttggcaatgaaaatgggata
atcgacatagtcaacaatgtggatcagcccatcgaacagcccttggaaaataatatcaat
gacccctcgaatttacgtgcagaagtggaggaggctattcgcaacccattcagagtatcc
catgtcagcattgagtctcatcttcagagtataagcgcacagttagcaaaaccccagcat
ttccatggcgctaccaatgagcggcagtctgcagttgtggcagcctttaagcactcgtgg
gctggttataagacttatgcctggggtcacgacaatctaaaacccgtttcccaaactgca
cacgaatggtttggtctaggactgtcaatcgttgattctctggacacaatgtatatcatg
ggcctagaagatgagttcaacgaggcacgcaattgggtcaaagatgctttgcatttccac
acaaatcgcgacgttaatctcttcgaggtaaccatacgtgtgctgggcggtttgctgtcc
gcttaccatttgagcggcgataggatgtttttggttaaagccactgagcttggcaatcgc
ttactgcccagttttctttcgccgtcgggcattccatattcagatgtgaatctgggcgaa
agatctgcacattcgccaaaatggtctccagatagttcaaccagcgaagtaacgactata
cagttggaattccgtgatctgagtcgctctacaaatgtttctatctatgagcgggtggta
aacgtagtgaatgaaaaagtacacgcactagataaaagtcacggcctggtgccaatattt
atcaatgccaacacgggcacctttagaaattatgcgacaatctcattgggtgcacgtggc
gactcgtactatgagtacttactcaagcaatggctgcaaacgggtcgcaaggataacgac
aatcttattttggactacatgcaagcgatagacggcgtattcacgcaattgatgcgacgc
acaccgcgcgaacactgggtatatataggggagctaattaatggtcatgactttaagccc
aaaatggatcatttgacatgctacttgcctggtactttattgcttggccaccagaatggc
atgcccgaatcgcatctactgctcgctaaggatttgttggacacgtgttatcaaacctat
gtcagacagcctactcaattggcagctgagatatcatactttgcgctgaccgacaaggaa
gagaatgatatatatgtgaagtcgaatgatgcgcacaacttgctgcgacccgagttcata
gaaagcttgtattacttttatgcactaaccgggaaccgcacatatcaggatatgggctgg
gtcattttccaggcattcgaaaagcattcaaaagtagctgcaggctacacatcactgggc
aatgtgaaaaacactttgaatactcgaatgcgcgatctcatggaaagcttctggttgagc
gagactttgaaatatttctatttgctatttagtgacaattgcagggaaatagacctcgac
aagtgggtcttcaactcggagggtcatccgctgcccgtgtaccagaactaa

DBGET integrated database retrieval system