KEGG   Drosophila mojavensis: Dmoj_GI23428Help
Entry
Dmoj_GI23428      CDS       T01062                                 

Definition
GI23428 gene product from transcript GI23428-RA
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
dmo  Drosophila mojavensis
Pathway
FoxO signaling pathway
Module
MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    Dmoj_GI23428
Enzymes [BR:dmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Dmoj_GI23428
Protein kinases [BR:dmo01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   Dmoj_GI23428
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 366 aa AA seqDB search
MSARKTQKFYKLDINRTEWEVPEIYQQLHPVGSGAYGQVCKARIRGTNTDVAIKKLSRPF
QSTVHAKRTYRELMLLKHMDHENVIGLLDIFHPHPPEATLEEFQNVYLVTHLMGADLNNI
IKMQNLSDDHVQFLVYQILRGLKYIHSAGVIHRDLKPCNIAVNEDCELRILDFGLARPTE
FEMTGYVATRWYRAPEIMLNWMHYSQTVDIWSVGCIMAELITRRTLFPGTDHIHQLNLIM
EMLGTPPDDFMRKISSDNARNYINSLPPTKRKDFKVVFKNANPLAIDLLEKMLELDADKR
ITAEQALAHPYLQKYADPGDEQTAPLYDQSFEEKDFSLEKWKELIYKEVMNFKPPASFAA
NLESNV
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcccgcaaaacgcaaaagttctacaagttggatataaatcgtacagaatgggaa
gttccagaaatatatcagcagctgcatccagtgggctctggtgcatatggacaagtatgc
aaggctagaattcgtggtaccaacactgatgtcgccattaagaagttatctcgtcccttc
caatcaacggtgcacgccaagcggacatatcgggaactaatgctattgaagcatatggat
catgaaaatgttatcggtctattagacatttttcatccgcatccaccggaagcaacttta
gaagaatttcagaacgtttacctggtaactcacctgatgggtgcggacctaaacaacatt
ataaaaatgcagaacctatccgatgatcatgtgcagttcctggtatatcaaatactgcgt
ggcctcaagtatatacacagtgctggcgttattcatcgagatctgaagccgtgcaatatt
gctgtaaacgaggactgcgagcttcgtatccttgattttgggttggcgagaccaactgag
ttcgaaatgacgggttatgtggccactcgctggtatcgcgctcctgaaattatgctcaac
tggatgcattacagtcaaactgtcgacatttggtcagtgggatgtatcatggctgagctc
atcacgcgacgcacacttttcccaggcacagaccacatacatcagctcaatttgattatg
gaaatgttgggcacaccgcccgacgattttatgcggaagatctcatctgacaacgcccga
aactatattaactcgctgccgccaacgaaacgaaaggactttaaagttgtttttaagaat
gccaatcctttggctattgatttgctcgagaagatgttggaactggatgcggataaacgc
ataacagccgagcaggcgctcgctcatccatacttacagaagtatgcagacccaggagat
gaacaaactgcgcctttgtacgatcaaagctttgaagaaaaagacttttcattggaaaaa
tggaaggagcttatttacaaagaagtcatgaattttaaacctccagcttcatttgccgca
aatctggaaagtaatgtatga

DBGET integrated database retrieval system