KEGG   Drosophila mojavensis: Dmoj_GI23433Help
Entry
Dmoj_GI23433      CDS       T01062                                 

Definition
GI23433 gene product from transcript GI23433-RA
Orthology
K03259  
translation initiation factor 4E
Organism
dmo  Drosophila mojavensis
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dmoj_GI23433
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    Dmoj_GI23433
Translation factors [BR:dmo03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    Dmoj_GI23433
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 171 aa AA seqDB search
MEKVASKQYESKIWPDLVDSDDSDVENEIDVDKLPPLEVGPNENRLQHTYCLWFSRKGTQ
RAATDYSKSLHVVGRCASVQQWWSLYSHLIRPTALKPYRELSLFKQGIKPMWEDPANSKG
GQWVIRLRKNKIERAWENVCMAMLGEQFLVGDEICGIVLQTKYPVSARFLK
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atggagaaggtcgcaagcaaacaatacgaatcgaaaatctggccagaccttgtcgatagc
gatgacagcgatgtggagaacgaaatagatgttgacaaattgccgccactggaggtgggg
cccaacgagaatcgcctgcagcacacatattgcctgtggttctcgcgcaagggcacacag
cgcgcggccaccgactatagcaaatcgctgcatgtagtcgggcggtgtgccagtgtgcag
caatggtggtcactctactcgcatctcataaggccaacggcgctgaagccctatcgggag
ctgagtctcttcaaacagggcatcaaaccgatgtgggaggatccggcgaacagtaaaggc
ggccaatgggtcatacgtttgcgaaagaacaaaattgagcgtgcctgggagaatgtctgc
atggctatgctgggtgagcaatttctggttggcgacgaaatatgtggcatagtgctgcaa
acgaagtatccggtaagtgcacgatttcttaaataa

DBGET integrated database retrieval system