KEGG   Drosophila mojavensis: Dmoj_GI23507Help
Entry
Dmoj_GI23507      CDS       T01062                                 

Definition
GI23507 gene product from transcript GI23507-RA
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
dmo  Drosophila mojavensis
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dmo00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:dmo00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 188 aa AA seqDB search
MLKYNLIVAVCENFGIGFKGDLPWRLKSELKYFSRRTKRINDPSKRNVVIMGRKTYFGVP
PSKRPLPDRLNIVLSTTLTQKELPEGVLLCGSLDEAMQTLEKKPLCDQVENIWIVGGSGV
YAEAMESPRCHRLYITKIQERFECDTFFPHIPASFHEVELTEDTPHGVQEENGIKFEYKI
LEKREHII
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgcttaagtataatttaattgttgcggtgtgcgaaaactttggcattggtttcaagggc
gacctgccctggcgtctaaaatcagagctgaaatatttcagtcgcagaacaaagcgaatc
aatgatccctccaagcgcaatgtcgtgatcatgggcagaaagacttattttggtgtgcct
ccctctaagcgcccactgcctgaccgtctgaatattgtactaagcaccacactcacccag
aaggagctgccagagggtgttttgctatgcggcagcctcgacgaggccatgcagacgtta
gagaaaaaacctctgtgtgatcaggtggagaatatttggattgtgggcggcagtggggtg
tatgcagaagcaatggagtctccccgttgccatcgtctctatataactaaaatccaagag
cgattcgaatgcgatacgttctttccccatattccggcgagctttcacgaagtagagctc
acagaggacacgcctcatggcgtacaggaggagaacggcattaagtttgagtacaagata
ttggaaaaacgcgagcatataatataa

DBGET integrated database retrieval system