KEGG   Drosophila mojavensis: Dmoj_GI23507Help
Entry
Dmoj_GI23507      CDS       T01062                                 

Definition
GI23507 gene product from transcript GI23507-RA
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
dmo  Drosophila mojavensis
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dmoj_GI23507
   00670 One carbon pool by folate
    Dmoj_GI23507
Enzymes [BR:dmo01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Dmoj_GI23507
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 188 aa AA seqDB search
MLKYNLIVAVCENFGIGFKGDLPWRLKSELKYFSRRTKRINDPSKRNVVIMGRKTYFGVP
PSKRPLPDRLNIVLSTTLTQKELPEGVLLCGSLDEAMQTLEKKPLCDQVENIWIVGGSGV
YAEAMESPRCHRLYITKIQERFECDTFFPHIPASFHEVELTEDTPHGVQEENGIKFEYKI
LEKREHII
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgcttaagtataatttaattgttgcggtgtgcgaaaactttggcattggtttcaagggc
gacctgccctggcgtctaaaatcagagctgaaatatttcagtcgcagaacaaagcgaatc
aatgatccctccaagcgcaatgtcgtgatcatgggcagaaagacttattttggtgtgcct
ccctctaagcgcccactgcctgaccgtctgaatattgtactaagcaccacactcacccag
aaggagctgccagagggtgttttgctatgcggcagcctcgacgaggccatgcagacgtta
gagaaaaaacctctgtgtgatcaggtggagaatatttggattgtgggcggcagtggggtg
tatgcagaagcaatggagtctccccgttgccatcgtctctatataactaaaatccaagag
cgattcgaatgcgatacgttctttccccatattccggcgagctttcacgaagtagagctc
acagaggacacgcctcatggcgtacaggaggagaacggcattaagtttgagtacaagata
ttggaaaaacgcgagcatataatataa

DBGET integrated database retrieval system