KEGG   Drosophila mojavensis: Dmoj_GI23552Help
Entry
Dmoj_GI23552      CDS       T01062                                 

Definition
GI23552 gene product from transcript GI23552-RA
Orthology
K12309  
beta-galactosidase [EC:3.2.1.23]
Organism
dmo  Drosophila mojavensis
Pathway
Galactose metabolism
Other glycan degradation
Glycosaminoglycan degradation
Sphingolipid metabolism
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:dmo00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:dmo00600]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:dmo00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:dmo00604]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:dmo00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:dmo04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 641 aa AA seqDB search
MNFSYGCLTLLSLVFIADLGSGSRSFTVDYENDRFLKDGRPFHFIAGSFHYFRAHPDTWS
RHLRTMRAAGLNAVTTYVEWSLHNPRDGVYVWTGIADLERFIRLAVDEDLLVILRPGPYI
CAERDMGGFPYWLLNKFPGIQLRTADINYLSEVRIWYSQLMARIGPYLYGNGGPIIMVQV
ENEYGSYFACDANYRNWLRDETQNHVKDSAVLFTNDGPGVLRCGKIQGVLATMDFGATSN
LKDVWAKLRQYQPKGPLVNAEYYPGWLTHWTEPMANVSTSAITGTFIDMLDSGASVNFYM
FYGGTNFGFTAGANDNGPGNYIADITSYDYDAPMTEAGDPTPKYMALRQIIGRYLPLPDM
PVPTPVPKRAYGTVRLLSCCTLFSDEGREKLSTGVVRSAKPKTFEALNQYSGLVLYESWL
PSQFKRDPSILHVRGLADRGYVYVDNEIVGILAREAPIFDLPLSPSMGRKLQILVENQGR
LNFGRQLNDFKGLTKDVRLDKQILINWNMTKYPLESYEDLETLVVQSTAAAQAGFKEIKQ
LKTILRNGPAIYYGTLTINSADDLADTYLDMSGWGKGIVFVNGENLGRYWPLVGPQITLY
VPAPVLRVGSNRLILVEYQQAPTVMEVQFRNTPILNSRRSN
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgaatttctcctatggctgcttgacgttgctgtcattggttttcatcgctgatctgggc
agcggcagtcgctcgtttacagtggactatgaaaatgatagatttctgaaggatgggcga
ccctttcatttcattgctggatcctttcactactttcgagcacaccccgacacctggtca
cgccacttgagaactatgcgtgcggcgggtctgaatgcggttactacttacgtggaatgg
tcgttgcacaatccgcgcgatggcgtctacgtctggacgggcattgcggatctggagcgc
tttatacgtttggctgtggacgaggatctgctggtgatacttcgccccggaccctacatc
tgtgccgagcgcgacatgggcggctttccctactggctgctcaacaagttccccggcatt
cagcttcgcacagctgatatcaattacttgagcgaggtgcgcatatggtacagtcagcta
atggcacgcataggcccctatctgtacggcaacggcggacccattatcatggtgcaggtg
gagaacgagtacggctcgtactttgcctgcgatgccaactatcgcaactggctgcgcgat
gagacacagaaccacgttaaagacagcgccgtgctattcaccaacgacggacccggggtt
ctgcgctgtggcaaaatacagggagttttggccacaatggactttggagccacgtcgaac
ctgaaagacgtctgggccaagctgcgacagtaccagcccaagggtccgctagtaaatgcc
gagtactatcccggctggctgacccactggacagaaccaatggccaatgtgagcacctca
gcaatcactggaactttcatagacatgcttgatagcggagccagcgtcaatttctacatg
ttttatggtggaaccaactttggattcacggcaggcgccaacgacaatggaccgggtaac
tacatagccgacatcaccagctatgactacgatgcgccgatgacggaggctggcgacccc
acgcccaagtacatggccttacgtcaaattatcggcaggtacttgccgctgccggatatg
ccagtgcccacgccggtgccgaagcgggcgtacgggacggtccggctgctcagctgctgc
acgctgttctccgacgagggtcgggagaagctgagcacgggcgttgtgcggtcggcgaag
ccgaaaacctttgaggccctgaaccaatactccggcctggtgctgtatgagagctggctg
ccgtcgcagtttaaacgggatccgagtattctgcacgttcgtggcttggcggatcggggc
tatgtctatgtggataatgaaattgtcggaatactggcacgggaagcacctatcttcgat
ctgccactgagtcccagcatgggcagaaaattgcagattctggttgagaatcagggacgg
ctcaacttcggtagacagctgaacgatttcaagggcctaaccaaggacgtgcgcctggac
aaacagatcctaatcaactggaatatgaccaagtatcccctggagtcctacgaagacttg
gagacgctcgttgtccagtccaccgcagcggcgcaagctggtttcaaagagatcaagcaa
ctgaaaacgattctacgcaacggcccggctatctattacggtacattgaccatcaacagc
gccgacgatctggcggacacatacctagacatgtccggctggggcaaaggtattgtcttc
gtgaacggcgaaaatctgggtcgctactggccactggtgggcccacagataaccctatat
gtgcctgccccggtgctgagggtgggcagcaaccgtttgattctagtggaataccaacag
gcaccgacggttatggaagtgcagttccgaaatacgcccatcctgaacagcagaaggtcg
aattag

DBGET integrated database retrieval system