KEGG   Drosophila mojavensis: Dmoj_GI23588Help
Entry
Dmoj_GI23588      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00231  
protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
dmo  Drosophila mojavensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Dmoj_GI23588
Enzymes [BR:dmo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Dmoj_GI23588
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     Dmoj_GI23588
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 478 aa AA seqDB search
MTTAVLGAGLSGLSAGYYLLRRFGKPLTIYEASPRVGGWIRTEGHKDRGFLFEGGPRTIR
PKGVAGANTLELIEELDLPIHPIPSSHVAAKNRMLYAKGQVCMLPNSPKGLIRTVPPFTK
PLYRALLHDLFTGSTLAKNEDESIYSFTKRRFGKEIADYAISPMICGICAGDAHEISVRF
LMETLFENEQKYGGVLKGAFYARFKDKVDEKKPGLFARGEPKLFKQATKEKWAMYGVEDG
LEQLPRAMRKYLGEHDVNVQLSSKCSNLTFNGDGARISLRDAEVPVKHVISALPAHQLAA
VVGAQHPSLAAQLLEIPYVDVVVVNIQYNSDQLLKHNGFGLLVPPVEKLPILGVIFDSCC
FDMAGNTILTVMMGGRWFDQWFGNQPSQKKLRDIAHQHVRQILQIKEEPVFSRVHMLHKC
IPQYTVGHKRRVENIRKYIKDYKLPLSVCGAAYDGVGINDVILSARRQVEELPSPSEP
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgaccacagccgtgctcggtgccggccttagtgggctatcagccggctattacctgttg
cgacgtttcggcaaacctttgaccatttacgaggcatctccacgcgttggcggttggata
cgcaccgaagggcacaaggatcggggcttcctgttcgaaggtggaccgcgaacaatacgc
cccaaaggcgtagcgggtgccaacacactcgagctgatagaagaactcgacctgcccatt
caccccattcccagctcccatgtggctgcaaagaatcgcatgctctatgccaagggacaa
gtgtgcatgctgccaaacagtcccaagggcctaatccgcacagtcccaccctttacgaag
cctctgtatagagctctgctccatgacttgtttacgggcagcactctggccaagaatgag
gacgaatctatttacagctttaccaaaaggcgattcggcaaggagatagccgattatgcc
atcagcccgatgatctgtggtatttgtgccggcgacgctcacgaaatcagcgtgcgattt
ctcatggagactctcttcgagaacgagcagaagtacggtggagtgctgaagggtgccttc
tacgcccgtttcaaggacaaagtggacgagaagaaaccgggcttatttgccaggggcgaa
cccaagcttttcaagcaggccaccaaggagaagtgggccatgtatggcgtcgaggacggc
ctggaacagctgccccgcgctatgcgtaaatatctaggcgaacacgatgttaatgtgcag
ttgagcagcaagtgttccaatctaacctttaacggcgacggtgcacggattagcctgcgc
gacgccgaggtgccggtgaaacacgtgataagtgctctgccagcacaccaattggcggcg
gtggtgggggcccagcatccatccctggcagcccaattgctggaaataccctacgtggac
gtggtggtggtcaacatccagtataacagtgaccaactgctgaagcacaatggcttcggc
ctgctggtgccgcccgttgagaagctgcccatactcggagtgatcttcgacagctgctgc
ttcgacatggcgggcaacacgatcctcaccgttatgatgggcggtcgctggttcgaccag
tggttcggcaaccagccgagtcagaagaagctgcgcgacattgcccaccagcacgtccgt
caaatcctgcagatcaaggaggagcccgtgttcagccgggtgcacatgctccacaaatgc
attccccagtacacagtaggacacaagcgacgcgtggagaacattaggaagtacatcaag
gactacaaactgcctttatccgtgtgtggcgcagcctacgatggcgtgggcatcaacgat
gtcatcttgtctgcgcgcagacaggtggaggagctgccatcgccgtcggaaccttga

DBGET integrated database retrieval system