KEGG   Drosophila mojavensis: Dmoj_GI23592Help
Entry
Dmoj_GI23592      CDS       T01062                                 

Definition
GI23592 gene product from transcript GI23592-RA
Orthology
K11853  
ubiquitin carboxyl-terminal hydrolase 34 [EC:3.1.2.15]
Organism
dmo  Drosophila mojavensis
Brite
Enzymes [BR:dmo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Dmoj_GI23592
Peptidases [BR:dmo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dmoj_GI23592
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 3905 aa AA seqDB search
MCEVCADFQNLLELYEVRVASSELKFQLLLKSEIETTFNYIQSWPQRQCMCLYRDNKNYD
RFNLVVQSLICLTVQHLKHIDHLIDSYKRLTASAAQVVAQAQRKPTSDKHPQHNENDIES
ENKQKELTSSSSCSPPSAGDENRSTLAEAGGNEEKRASGDGPGPPKKPPSPPPPAPPTSS
KAHPQYTEEPWILPEVEKLLVLVSKVFLLNFPLYIAHKHGMHSRLDDLQAEEAHHLALIC
DLHDNDLPIYLLRNVSLFCNSGGFGAMSLCFEHPDLPVSTAHSMTATVSNVKLWLNYHCN
TQLFVPLRSRILQYMCKLSDQNLRSAATRAMADFVWSSMRDPLDVAVNFDTEGLALAFKY
FTSTTLTMRLAGMAQINAHINLFNEICTTETVNEVELFGQRIANWLTENQIVQHLFGPNL
HVEIVKQAHVLLNFLAVENQISEEDIKLIWQATQLKHCSKTIFDILPALVKNLAPRPAMH
LYSLLCRMDPKEHTEQSIYIASALTKLIWTRDCTRSQMNLIQDHLLGSNVTASSSDSGSI
EGSNTEDEHVGADDSSIASGGGGGGHKSPVDGVTPCKQARHRRHICDPTTEKAKQLSGDD
IAKIDIKNHRIVNIIDNTSSEEELQSRAALELQLHRKKTSNKRRRPKATNKPQILPHELV
EIWDGVEDVPSSDDGDADGDGELLADSDECSDSAGHQLVPAAVLKHLHGEGPYIRAIAET
NISELLSGAENDGSYSSPMSNKSEKNLADFDDEDVSPCEEELAQLVNSHGARVAAPNCRD
VAPAFAAAAAALMAAQSAMAMQKSGETNVAAAAAAVAAAAVATGNAQQSLVAMRQQANAA
AAVAAAAAAKTKSDSDVDLIEVANKQLHSPKPSNVVSTNNQPSFKLNDVCQPGNTLLWDL
LQDDKIGQLGESLALEAEKALATLLCFSMDRQLRTKFIEGCLQNVANNRSVIVSLRLLPK
LFASFQQFRPSDTHTMTLWAERNHRMMACFFNNIRHYARRHAELLINQNGEQQQQQLGLQ
LYSHKTQVSVRLQFLSSIFSSVGSPKSFRLTLEQLDALWDWLAHDPECSDCYFSWLQAQT
KGGDQHALGIDALHHLYLKKLPELRPEEFSMVALGLFQQLCSFARIAMAEYEKHSDAISA
NSNAVGMYHLWKIALRAQSNEVSLAAIQYINMYYMGQQLRLEKEFVSQCMDNLVQAATAL
ECIEDENALMRVQRGLLLLNTHLDTFRRRYAFHLRRWAIEGKGIGSHSNLKNEGSGPPLR
IVLQQAGLSEKSLLHMHACDLIADLKAEVSKWWESLQSGMAAPVLGLLLSDGPLRIITQG
QELTSDYDERSLGDAGFKDNQIVYVSLGGRGARRKETNVEHPSMLPPPPKECLPTVLLLQ
PKYFEKLFCLMQTLGDMKPQSSTAHLQHHTKAQLLSRRVWDILAMLPTNPHILDAFKNLV
NDLNELQQLEDQEQLANKRKEIKQKFNELLDPSNLQKFMYSLHIVESLALSSGSRQATAS
NAPSAPAGTGSNGNLVITEQPRAKKGTNRRHNSIEQAGEPKRSSSSSDCSKELAAGEMET
SLISNPRSGSDVDISELASGGDKENQPKQHCKRQKKIDNLEVERPLGCATPPPPSPTSTL
PVAAAAPVRSAAPAESSKWSEAFIKCGGLQHLYEIFIGGQLQQSAHAKELALNEWRHDCL
ASLLRILWLLGFEELQTQDVHVLMSRPHAFMLQLMEVPQCLQRLSSILNDEVHQQQSAGA
TSLLFPYQFHQLRTGFWGRAQLVQFTMNILVSFVHASAEARRLLWSQPDQCNWLQKFILE
DPEPAVRREICAGLYRICLGNAQSYRLLLAPLLHKLIALLPRAEQMSSSVQHTQFLLSEE
GKEPYGPACRDYFWLLARLVDTLTPEMVAEERIDIEQLCESISESILNRDYYELRHGYQD
DGLVGLLNLMSNLIKYDTSYKYRPKALSFIEQLIEFLFEMPSPANRQKPKCKSATSRAAA
YDLLVELCRGCATNYSYLHGRLLAQHRSGPKQPYPWDYWPRDEGRAECGYVGLTNLGATC
YMASCIQHLYMMPQARAAILRLPPAGAQKHGPTLMELQRMFAYLLESERKAYNPRSFCRV
YQMDHQPLNTGEQKDMAEFFIDLVSKLEEMTPDLKHLVKRLFCGTLSNNVVSLDCGHVSR
TAEEFYTVRCQVADMRNLQESLDEVTVKDTLEGDNMYTCSQCGKKVRAEKRACFKKLPQI
LCFNTMRYTFNMVTMLKEKVNTHFSFPLRLNMCHYVEKTLMPQQYKEDREKRIRERQEND
NDEGAENEKAEATLDADIEECYEYELVGVTVHTGTADGGHYYSFIKERTKSNYHPHERWF
LFNDAEVKPFDPSQIAAECFGGEMTSKTYDSVTEKYLDFSFEKTNSAYMLFYERRLPEHL
QRRHSELLATPTPSPLNEDKPEAEEQPKVETDNNIKKEPAGAEDTEPVQAEAEKSAPLST
ETEKLKEEEQTEKPDPTQINEDKEMEKVTANCDNIKSNNNNEPQASTSKAVVVADAKAST
KQQQFRPLLSKELEDWIWQDNRQFLQDRNIFEHTYFNFMWQICGHIPQTLISETDVTCMA
AKLSVSFFIETFIHAKEKPTMVPWVELLTKQFNASEEACEWFLSHMSVEPFWPVQVLIQC
PNQMVRQMFQRLVVHVIQRLRASHADLYLGVDTDENDRELIGQASCVTRFISSLISLLEH
GARSHLRHLSEYFSLLCEFSRMGDEEAMFLLRIGVLKSLVDFYLGHKQSDSIDISSDNED
NSSDEALSVEKMRPASLDKMIALCASLVERSRGADFRLRLSPKDFNAIAGGKGFPFLYQQ
IKDGINPHQTKHLIHALCRWDDRLATQIINMLFASVTKHTELCAPFFKLLTLLTETQGGP
VGLPCFTQLVLPRMWDAAEYCPQSVLDWLSLQATKNKIAHAWILQSAEQWLEQFLLAHDN
TRVRNAAACLLVALVPSQPFRANFRAHSQHKLLALNPHSYRDINSDAQAVLHQVITLLLR
LLRPARVYADIGAHGTTKLTAYFNLLSYCMVSKTEKLMIGSFMRSLWELFHPRLSEPSVP
AHHNKHALLTFWHHSLVDCPENAALVANCPEITRNIAFNYILADHDDSEIVTYNRSMLPA
YYGLLRLCCEQSRALTRQLAQHQNLQWAFKNITPHPTQYAAAVDELFKLMALFATRHPDA
SEQEKLDVIAFRRSVIVSYTTSLDARVSWSTLISALKILVDNDDDRMLVIFNGGIEMCFE
ALHTLHSMHHEATACHVAGDLLDLLGEMVLLLATLRMRTDNPAQKKQQQQQLEQQLQLQQ
QQLLQKQQQSQCTQAPQTPQQKEKQLQQQMQQHLQLQQMQLQQQHFLRQQHQHSALAKAL
PDAIKRLATLLNTFNSPEISRMALEVLKELVRNTSLEATTILAPILINCHLSVANAPNAI
GPLGPYFPRRGAKQTPWPLGAKNSPRPPRPMVQMCIALSELTPRGLDTEYDAQVDAFYRP
YHDFIDVMMRMCVNTGTLNDTLVKLHCLVAIESTPLHFNYFPKFWVGIHNNALTNKYSDL
LVRNPLLIEYLHNVLRDERSMLKDAFVREFLELYYHKVAAQLPVARMIYTINYGMHSKDD
IDELCGDLFAIRVIAQATGVPTSVRKELRGSLRALLNKSERYKKEAERDQFPNKKQKRES
SKEKEEPHSTGPSEADKADNPTESTEKAAPVDNASAADVSADAPKPPTVADAGDERMRSP
ASENQEKASVPSSDDETELEDELEPTPKRNKKSANKKTAQDRLNEDRKKRLSTLLTMESY
IHSIFAIIKRETNASNSAQGKEHEEFTVEPSTSAAAGILLKPKGATTPPEIEDNVTQGKY
SIEMDTESPVKSKSNDTVQEMDKPDETSPAMKSVVNAVNAVVPTAVAAPATVVASTSQAA
SPSQI
NT seq 11718 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgaagtttgcgccgatttccaaaatctattggaactctatgaggttcgcgtggcc
agttcggagcttaagtttcagctgctgctaaagagcgaaatcgagacaacatttaattac
attcaatcgtggccgcagcggcaatgcatgtgcctgtaccgggataacaaaaattatgat
cgatttaacctagttgttcagtcgctcatctgtctgaccgtgcagcacttgaagcatatt
gatcatctgatcgatagctacaagcggctgaccgccagcgctgcccaagttgttgcccaa
gcacagcgaaagcccacatccgataaacatccacaacacaacgaaaatgatatagaaagc
gagaacaagcaaaaggaactgacgtcttcatcgtcatgctcaccaccatcagctggtgac
gaaaataggtcaacccttgcagaggctggcggcaatgaggagaaacgtgcatctggcgac
ggcccaggtccgcccaaaaagccgccgtcgccaccaccgccagccccaccaaccagcagc
aaggctcacccacaatacacagaagagccgtggatactgcccgaggtggagaaactgctg
gtgcttgtatccaaggtttttctgctcaactttccgctgtacattgcccacaagcatggc
atgcactcgcgcctggacgatctacaagccgaggaagcacaccacctggctctaatctgt
gatctgcacgacaatgatcttcccatatacttgctgcgcaacgtgagccttttctgcaat
tcaggcggctttggtgcgatgtcgctgtgcttcgagcaccctgatttgccggtatcgacg
gctcactccatgactgctacagtgtccaatgtgaagctgtggctcaactatcactgcaac
acgcagctgttcgtgccgctgcgcagtcgcattctacaatacatgtgcaagctctccgat
cagaatcttcgctcggccgcaactcgagcaatggctgacttcgtctggtcatctatgcgg
gatcctcttgacgtagctgtcaacttcgatactgaaggacttgcgctggccttcaagtac
ttcacatcgaccacattgacgatgcgtctggcgggtatggctcagattaacgctcacatc
aatctgttcaacgagatttgcaccactgagactgtcaacgaggtggagctctttgggcaa
cgcattgccaattggcttactgagaatcaaattgtgcagcatttgtttggcccgaactta
cacgttgagattgtaaagcaagcccatgtacttctgaacttcctcgctgtggagaaccag
atctctgaggaggatatcaaactcatctggcaagcgacacagctgaagcattgctctaaa
accattttcgatattttgccggcgctggttaagaatctagctccacgcccggccatgcat
ctctattcgctgctctgccgcatggaccccaaggagcacaccgagcagagcatttacatt
gcgtccgctctgacaaagctgatttggacgcgggactgtacgcgcagtcaaatgaactta
atacaagaccacttgctgggctccaatgtgacagcctccagctcggacagcggcagcatt
gagggcagcaacacggaggacgagcatgtgggcgccgacgacagcagcatcgccagtggc
ggcggtggtggtggtcacaaaagtcccgtcgatggggtaaccccttgcaagcaggccagg
cacaggcgccacatctgtgatcccaccactgagaaggccaagcagctgagcggcgatgac
atcgccaagatagacatcaaaaaccatcgcattgtcaacatcatcgacaacaccagcagc
gaggaggaactgcagtcgcgcgctgccttggagctgcagctgcaccgcaagaagactagc
aacaagcgccgccgtccgaaggctaccaacaagccgcagatactgccgcatgagctggtg
gaaatttgggacggagtcgaggatgtgcccagcagcgatgatggggatgccgacggcgac
ggcgagctgctcgcggacagcgatgagtgcagcgacagtgccgggcatcaactggtgccc
gctgctgtgctgaagcatttgcacggcgaaggtccctatatacgagccattgccgagacg
aacatcagcgagctactgagcggagcagagaacgatggcagctactcgtcgccgatgagc
aacaaatcagagaagaatctggccgactttgacgatgaggacgtatcgccctgcgaggag
gaactggcacagctcgtcaattcgcatggcgcacgcgtagctgctccgaattgcagagat
gtggctccggcctttgccgcggccgcagctgctctgatggccgctcagtcggccatggcc
atgcaaaagtccggcgaaacgaatgtagccgccgctgcagctgctgttgcggctgctgct
gttgccactggcaatgcacaacagtccttggtggcgatgcgccaacaggcaaacgccgct
gccgccgttgctgctgcagccgctgccaagaccaagtccgactcggatgtggatctaatt
gaggttgccaacaagcagctgcactcgccgaagcctagcaatgtcgtctcgaccaacaat
cagccatccttcaagctgaacgacgtctgccagccgggcaacacgctgctctgggacctg
ctacaggacgacaaaattggacaacttggtgaatctttagcattagaggctgagaaggcg
ctggcaactctgctgtgctttagcatggaccgccagctgcgcacaaaatttattgagggc
tgcctgcagaatgtggccaacaatcgcagtgtcatcgtgagcttgcgcttgctgcccaag
ctctttgcatcattccagcagtttcgaccatcggacacgcacaccatgaccttgtgggcg
gagcgcaatcatcgcatgatggcgtgcttcttcaacaacattcggcactacgcccgaagg
cacgccgagctgttgatcaaccagaatggagagcagcaacagcagcagctgggccttcag
ctgtactcgcacaaaacgcaggtctctgtgagattgcagtttctctcgtcgatcttctcg
tcggtgggttcgccaaagagctttcgcctgacgctggagcaactggatgcgctgtgggac
tggctggcgcatgatcccgagtgctcggactgctatttctcgtggcttcaggctcagaca
aagggcggcgatcagcatgccctcggcatcgatgcactgcatcatttatacttaaagaaa
ttgcccgaactgcgaccagaagagttctccatggtagcactgggtctcttccagcagctg
tgcagctttgcgcgtatcgcaatggccgagtacgagaagcacagcgatgccatcagtgcc
aattccaatgccgtgggcatgtaccatctctggaagattgcgctgcgcgcccaaagcaac
gaggtctcgctggctgcgatccagtacatcaacatgtactacatgggccagcagctgcgt
ctggagaaagaattcgtatctcagtgcatggacaatctggttcaggcagctacagctctg
gaatgcatcgaggatgagaacgcgctgatgcgcgtgcagcggggactgctgcttctcaac
acccatctggacacgtttaggcgtcgctatgccttccatttgcgccggtgggccatcgag
ggcaagggaatcggttcgcacagcaatctgaagaacgagggctctggtccacctctgcgg
attgttctccagcaggcaggtctctcggagaagagtctgctgcatatgcacgcatgtgat
cttatcgctgatctcaaggcagaggtttcaaagtggtgggagagcctgcaatcgggcatg
gcggcgcccgtgttgggcttgctcctcagcgacgggccactccgtataatcacacagggc
caggagctgacatcggactacgatgagcgctcactaggcgacgctggttttaaggacaat
cagatcgtttatgtgtcgctgggtggacgcggtgctcgtcgcaaggagacgaatgtggag
cacccgtcgatgctgccgccaccgcccaaggagtgtttgcccacagtgttgctcctgcag
cccaagtacttcgagaagctcttttgtctaatgcaaacgctgggtgacatgaagccgcaa
tcctcaacggcgcatctgcagcatcacacaaaggcgcagctgctgtcgcgtcgcgtgtgg
gacatcttggcaatgctgcccacaaatccacatatactggatgcattcaagaacctggtc
aacgatctcaatgaactgcagcaactggaggatcaggagcaactagccaataagcgcaag
gagattaagcaaaagtttaacgagctgcttgacccgagcaacctgcaaaagttcatgtat
tccttgcacatcgtcgagagcctagcactaagcagtggatcacgccaggccactgcctct
aatgctcccagtgctcctgcgggcacgggatccaacggcaacctggtcataactgagcag
cctcgtgccaaaaagggcacgaaccgtcgccacaacagcattgagcaggccggagagccc
aaacgcagcagcagcagcagcgactgcagcaaggaactggctgcgggggaaatggagacg
tcgctgatttcgaatccacgatcgggcagcgatgtagacattagcgagctggcaagcggt
ggcgacaaggaaaaccaaccgaagcagcactgcaagcgacagaagaagatcgacaatctg
gaagtggagcgcccattgggctgtgccacgccgccgccgccctcgccaacatccacattg
ccggtggcagcagcagctccagtgcgcagtgcggcgcccgctgagagcagcaagtggagc
gaggcattcatcaagtgcggaggattgcagcatctgtacgagatcttcatcgggggccag
ctgcagcagagcgcgcatgccaaggagctggcgttgaacgagtggcgtcacgactgcttg
gccagcctgctgcgcatcctgtggctgctgggcttcgaggagctgcagacgcaggatgtg
catgtgctgatgtcgcgaccacatgccttcatgctgcagctgatggaggtgccacagtgc
ctgcagcgcctctcgagcatactcaacgacgaagtccaccagcagcagtctgccggagcc
acttcgctgctgttcccctaccagttccatcagctgcgtactggcttctggggtcgagca
cagctggtgcagttcaccatgaacatcctcgtgagttttgtgcacgcctcagccgaggca
cggcgtctgctctggtctcagccggatcagtgcaactggctgcagaagttcatactggag
gatccggagccagcggtgcggcgcgagatctgcgccggtctctatcgaatctgtttgggc
aacgcccagagctaccggctgctgctagctcctctgctccacaaacttatcgcactgctc
ccgcgtgccgagcagatgagctcgtctgtgcagcatacgcagttcttgctctcggaagag
ggcaaggagccgtatggcccagcttgtcgggattacttttggctactcgcccgactggtg
gacacgctgacccccgagatggtggccgaggagcgcattgatattgagcagctttgcgag
agcatctcggagagtatcctgaaccgcgactactacgaactgcgccatggctaccaggat
gacggcttggtgggcctgctcaatctgatgtccaatctgatcaagtacgacaccagctac
aagtacaggcccaaggccttgagcttcattgagcagctgatcgaattcctgttcgaaatg
ccatcgcccgccaatcgccagaagccgaagtgcaaatcggccacctcgcgtgccgctgcg
tacgatctgctcgtggagctgtgccgcggctgtgccaccaactacagctacctgcatggc
cgactgctggcgcagcacaggtcgggtccgaagcaaccgtatccctgggactattggccc
cgtgacgagggccgtgccgagtgtggctatgtgggcctcacgaatttgggagccacctgc
tacatggcctcctgcatccagcatctgtacatgatgccacaggcgcgtgcggccatttta
cgtctgccaccggctggcgcccaaaagcatggccccaccttgatggagctgcagcgcatg
ttcgcgtatctgctggagtcggagcgcaaggcgtataatccgcgcagcttctgccgagtg
tatcagatggatcatcagcccctgaacacgggcgagcagaaggatatggcggagttcttc
attgatctggtctctaagctcgaggagatgacgccagacctgaagcacttggtgaagcgc
ctgttctgcggcactctgagcaacaatgtggtctcgctggactgcggtcacgtttcgcgc
accgcagaggagttctatacggtgcgctgccaagtggcggacatgcgaaacttgcaggag
tcgttggacgaggtgaccgtcaaggatacgctcgagggtgacaatatgtacacctgttca
cagtgtggcaagaaggtgcgcgccgagaagcgcgcctgcttcaagaagctgccgcagatc
ctgtgcttcaataccatgcggtacaccttcaatatggtgaccatgctgaaggagaaggtc
aacacgcacttttcgtttcccttgcgcctcaacatgtgccactatgtggagaagacgctg
atgccgcagcagtacaaggaggaccgtgagaagcgcatacgcgagcgtcaggagaacgac
aacgatgagggggcagagaatgaaaaggctgaagccactttggacgcagacatcgaggag
tgctatgagtacgaattggttggcgttacggtgcacacaggcacagcggacggtgggcat
tactatagctttatcaaggagcgcacgaaaagcaactatcatccgcacgagcgttggttc
ctgttcaatgacgccgaagtcaagccattcgatccgtcgcaaatagcggccgagtgtttt
ggtggcgaaatgactagcaagacctacgactcggtaaccgaaaagtatttggactttagc
tttgagaagaccaactcagcttatatgctgttctatgaacgtcgattgccagagcatctc
cagcgtcggcactctgagttgttggcaacgccaacgccaagtcctcttaatgaggataaa
ccggaagcggaggagcaacccaaagttgaaacggacaataacatcaaaaaggagcccgct
ggagccgaggatacggagccagttcaggcagaggccgagaaatcggctccgttaagcaca
gagactgagaagttaaaagaggaggagcaaactgaaaagccagacccgactcaaataaac
gaagacaaggaaatggagaaagtaacagccaattgtgataatattaagtcgaataataac
aatgagccgcaggcgtcaacctcaaaggcggtcgtcgtcgcggatgccaaagcatctact
aaacagcaacagtttcgtcctttgttaagcaaggaactggaagattggatttggcaagac
aacagacagttcttgcaagatcgaaatatcttcgagcacacatactttaacttcatgtgg
caaatttgcggccacataccacagacgttaatctcggagacggacgtcacctgcatggcc
gccaagttgtccgtgtcatttttcatagaaacattcatacatgccaaggagaagcctaca
atggttccttgggtggagttgctaacaaagcaatttaatgccagtgaagaggcttgcgaa
tggttcctatcgcacatgtcagtcgagcccttttggcccgtacaggttctaattcaatgc
cccaatcaaatggttcgccaaatgtttcagcgtttggtcgttcatgtcatacagcgactg
cgcgcttcacatgctgatctctacttgggcgtggatacagatgagaacgaccgggagctc
attggacaggcatcatgtgtgacgcggttcataagctcgctcatctccctgctggagcat
ggagcgcgctctcatctgcgccacctttccgagtacttcagcttgctgtgcgaattctcg
cgcatgggagacgaggaagcgatgtttctgttgcgtatcggagtacttaagagcctggtc
gacttctacctgggccacaagcaatcagatagtattgacatcagctcagataacgaggac
aactcttcggatgaggcactctcagtagaaaaaatgcgtccagcgtcgctcgataaaatg
attgcactctgtgctagtcttgtggagcgttcgcggggcgctgattttcgactgcgtctg
tcgccgaaagacttcaacgccattgccggtggaaagggatttccatttttgtatcaacaa
ataaaggacggcattaatccgcatcagacaaagcatttaatccacgcgctctgtcgctgg
gacgatcgtttggctacgcaaatcatcaacatgctcttcgcatccgttaccaagcacacc
gagctctgtgcgccgttcttcaagctgctcactctgctcaccgagacgcagggcgggcct
gttgggctgccgtgctttacgcagctcgtgctgccgcgcatgtgggatgctgccgagtac
tgtccgcagtccgtgctcgactggctttcgctgcaggcgaccaaaaataaaatcgctcac
gcctggatcctgcagtccgccgagcaatggctggagcagttcttgctcgcccacgacaat
acgcgcgtcagaaatgccgctgcctgtctgctagtggcgctggtgccgtcgcagccgttc
cgcgccaacttccgcgcccactcacagcacaagctgttggctctcaacccgcacagctac
cgggacatcaacagcgatgcccaagcggtgctgcatcaggtgataacattgctgctgcgt
ctgctgcgtccggcgcgtgtttatgcagacattggtgcacacggtaccaccaagctgacc
gcctatttcaacctgctcagctactgtatggtttcaaagactgaaaaactaatgataggt
tcgtttatgcggtccctgtgggagctgtttcatccgcgtctctctgagcccagcgtgccg
gcgcatcacaacaagcacgcgctgctcaccttctggcatcactcgctcgtcgattgcccg
gaaaacgcagcgctggtggccaactgtcccgagataacgcgaaacattgcatttaattat
atactggccgatcacgatgactcggagattgtcacttataatcggtccatgctgcccgct
tactacggactgctgcgcttgtgctgcgagcagagccgcgcactcacccggcaactggca
cagcatcagaatctacagtgggcttttaagaacattacgccccatcccactcagtatgca
gccgctgtcgatgagttgttcaagttgatggcactgtttgccactcgccatccggatgcc
agtgagcaggaaaaacttgatgtcattgccttccggcgctctgttattgtatcgtacacc
accagcctggatgcacgagtgtcctggtcaacgctgattagcgcgctgaaaatacttgtg
gacaatgacgatgatcgcatgctggtcatcttcaatggcggcatcgagatgtgctttgag
gcgctgcacacgttacattccatgcaccacgaggccaccgcctgccatgtggcaggggat
ctcttggatctacttggagaaatggtgctcctgctggcgacgctgcgcatgcgcacagat
aacccagcgcaaaagaagcaacagcagcagcaactggaacagcagctgcaactgcagcag
cagcaattgctgcagaaacagcagcaatcacaatgcacccaagcgccgcagacaccgcag
cagaaggagaagcaactgcagcagcaaatgcaacagcatctgcaattgcagcaaatgcag
ctgcagcagcaacactttctgcgtcaacagcatcagcattcggcactcgcaaaggccctg
cccgatgccatcaaacggctcgccacgcttctcaatacatttaattcgccggaaattagt
cgcatggcgctcgaggtgctcaaggagctggtgcgcaacaccagcctggaggccaccact
attctggcgcccattttgatcaactgccatttatcagtggccaatgcgcccaatgcaatt
ggcccattaggaccatattttccacgtcgcggtgccaagcagacgccctggcctttaggt
gctaagaactcgcctcgtcccccgaggccaatggtgcaaatgtgcattgctctgtcggag
ttgacgccacgcggtctcgacaccgagtacgatgctcaagtggatgccttctacaggcca
tatcacgacttcatcgatgtcatgatgcgtatgtgcgtcaatacgggcaccctcaacgac
acgctggtcaaacttcactgcctggttgccattgagtccacaccgttgcatttcaactac
tttcccaagttttgggtgggcatacacaacaacgccttgacaaataaatattctgatttg
cttgtgaggaatccgctgctgatagagtatctccataatgtgctaagagacgagcgaagc
atgctgaaagatgcatttgtgcgggagttcctggagctatactaccacaaagtagccgcg
cagcttcctgttgcacgcatgatctacacgattaactatggcatgcactccaaagacgac
atcgacgagctgtgcggtgatctgtttgcgattcgcgttattgcccaagccactggtgtg
ccgacatccgtgcgcaaggagctgcgtggctcactgagagcactgcttaataagagtgag
cgctataagaaggaagcggagagagatcaatttcccaacaagaaacagaaacgggaatct
tccaaagaaaaagaagaaccacattccactgggccatcagaggcagataaagcagacaat
ccgacggaaagcacagagaaagccgctccagtggacaatgctagtgcggctgatgtgtct
gcggatgcgcccaagccaccgacagtcgctgacgcgggagatgagcgtatgaggagccca
gcatcggaaaaccaagaaaaggcatcggtgccctcatcagatgatgaaactgagctggaa
gatgaattggaaccgacacccaaacgtaataagaaatcagccaacaagaaaactgcacag
gatcgtctgaacgaggatcgcaagaagcggctgagcaccttgctcacaatggagtcttac
atacacagcattttcgcaatcatcaaacgggaaacgaatgcgtcgaatagtgcgcaaggc
aaggagcatgaggaattcacagtagagccatcaacatcggctgctgcgggaatcttgcta
aagccaaaaggtgctacaacacccccagaaatcgaggacaatgtgacgcaaggcaaatac
agcattgaaatggacacagaaagtccagtcaaatcgaagtcaaatgacacggttcaggag
atggacaaacccgacgaaacgtcgcctgcaatgaaatcagttgtgaacgcagtgaacgct
gttgttcccacagctgtcgccgccccagcgacagttgttgcatccacatcacaggcagcg
agtcccagtcaaatttag

  All links  
No link information was found.   
DBGET integrated database retrieval system