KEGG   Drosophila mojavensis: Dmoj_GI23615Help
Entry
Dmoj_GI23615      CDS       T01062                                 

Definition
GI23615 gene product from transcript GI23615-RA
Orthology
K11418  
histone deacetylase 11 [EC:3.5.1.98]
Organism
dmo  Drosophila mojavensis
Brite
Enzymes [BR:dmo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     Dmoj_GI23615
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 323 aa AA seqDB search
MKREAPEARDKLPIVYSKKYAVRFGGLEKLHPFDAAKGKHIQQLLCAELSLECGDFYNPL
EITKEELLRVHTPKYLRSLKWSAKVATIAEVPVLIFVPNVGVQSGYLRPMRYQTAGSILA
GKLALEYGWAINLGGGFHHCCSSKGGGFCPYADITLLLVRLFDLEPLRVRNAMIVDLDAH
QGNGHERDFKDTETVYILDMYNAYIYPKDNEAKLSIRCAVELKHLTEDAHYLKQLNRCLM
RALAEFKPDIVVYNAGTDILKGDPLGNLAITPDGVIERDRLVFSTFRALNIPIVMLLSGG
YMKSSKNVIADSIVNLKRQGWLK
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtgaggctccggaggcacgtgataagttgcctatagtgtactccaaaaaatat
gctgtgcgctttggtgggcttgaaaagttacatccttttgatgcagctaagggaaagcat
atacaacagttactctgtgcggaactgtcgttggaatgcggcgatttctacaatcccctt
gagattaccaaggaggaactattgcgagtccacactccaaagtatttgaggtccctcaaa
tggagcgccaaggtggctaccattgcggaggttccggttctcatatttgtgcccaatgtg
ggagtgcaaagtggatatctgcgaccaatgcgctaccaaacagctggctccatcctggct
ggcaaactggccctggaatatggttgggcgatcaacttaggcggcggcttccatcattgc
tgctcgtccaagggtggtggcttttgtccctatgcagatattactctgttgcttgtccgt
ttgtttgatttggagccgttgagagtgcgaaacgcaatgattgtagacttggatgcgcac
cagggcaatgggcatgagcgggactttaaggacactgagacggtatacatacttgatatg
tacaatgcctatatctatccaaaggataacgaggccaagctgagcattcgttgtgctgtt
gaattgaagcatctcaccgaagatgcccactacctaaagcaactgaaccggtgtctgatg
cgagcacttgctgaatttaagccagatattgttgtttataatgccggcaccgatattctc
aaaggcgatcctctaggcaatttagcgattactccagacggagttatagagcgcgaccgc
ttggtctttagtacatttcgagcactgaatatacccattgttatgttgcttagcggcgga
tacatgaaatcatccaagaatgttattgcagattcgatagtcaatttgaagagacaggga
tggctaaaataa

DBGET integrated database retrieval system