KEGG   Drosophila mojavensis: Dmoj_GI23660Help
Entry
Dmoj_GI23660      CDS       T01062                                 

Definition
GI23660 gene product from transcript GI23660-RA
Orthology
K14316  
nuclear pore complex protein Nup121
Organism
dmo  Drosophila mojavensis
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dmoj_GI23660
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1317 aa AA seqDB search
MEHRYGLSNSPRLSKPMADSTWIGGMSATQRSMTQQMQRSSISREHNNSSLCLSNSFTND
SPQNRSLHTTSRTSSVSKTARQRLNLSHMDPKTFADVNSSGLASRIVEYQRDRSTGGRGL
QRSISYNNIYNPLTQPRRCSIASSPLSHKPNLPSVSITRMAPPERSFYCGNTLPSLLRSN
SLVGVEKKSDQQLSRENRPIMHPPPLQHESEPTRSVLEELKEISRKRINSGEIQPNDYTS
KKSCNRLTDYVDHHLHQQHQPQQHQLSMLQSQSGFKRQRELTVTVPRRLHHTAIALPHQH
QHHTLHMSAHHFPERISPQQSPEQQAKRRNCSYSNDIASSLSSSQLHSNKRKLYDMRSAS
NTSALNDNASNGSNNNSSPETSPRPQVAKIQRSQAATTDLHLENLTRTQSTPITPLPATP
AQRAASAPLVEAKYDQKPKLTLFNAQQRQPQQKQQQQEPPEPQQQQQQHTQQQVDLDSPD
VDANEYAGIQFVRPKQDQSLVTSKNSHLERTQKTKLALMLSSLRGEIFQDETSADEADTS
TTTSSVAPTTKNTNQATNTNVTTNTASTKPTILATATVSAAPAQSVSTTITETEARTTTT
SATTMSALTPAPTTASNSTLSVLPGKSTENATIGTGAVLGFTLPTATEKPATTTTAESTP
VLTFTNSKTTATTTTGSTGSPAFTFGKPAAAADAKQTPAPTETLATTATPATKDPAKTPF
TFGTGANNAQATGAGLGAQAAAATAVQPAPSAPLSFNFGKPASGAATSSTLITTSATAPT
TTAASTSVFSFGTAPATTTAATSNNPLIFGSSNSNSETGATIVTTAAPAASQPKEPSPFG
SSSSNSNSFAIGFKSPATPAAAVTAAPSAPAIFSFGKTPAAPAAPVVFGSSTATTTTTAA
TAQPAFNFGGTATATDSASAASATTSNTNAVSAATPAANNSNIFAFGGDSKPTVKATPFT
LPNKSDSNNIFSFGAGGDGAKMAATPATGAKATVPSAFNFGGSASAAPVGGAPATNAFSF
SAPNKSTPLFGASNATESKPFTFGATESTQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ
QQQQQQQQQTTPAVGGFSFSAVIPKSESTNLFKSPLAVGAGGVKPSFNFGGNTTLGTAAA
TPAGAATSGNGFGGFAAPAPAPAAAPAPSAANNQKLFTFGSSATPSNGANQSGNLFASAV
SAVQNQQQTKPGGFSFGASNAANSSNATNGNANAPFAFGGITSPQGSGVNAANKPFTFGN
PAPSINGSAPFTFGSGVNAPSTPTSAPGMPGQQMNRFAPPTTPENRPIRRATRRLQK
NT seq 3954 nt NT seq  +upstreamnt  +downstreamnt
atggagcatcgttacggcttaagcaattcgccgcgtttgtcaaaacccatggctgattcc
acatggattggtggcatgtctgcgacgcagcggtcaatgacacagcaaatgcaaaggagc
tctatatctagggagcacaacaactcgagcctttgtctaagcaatagcttcacaaatgat
tcaccgcaaaataggagtctacatacaacatcgagaacatcgagtgtatctaaaacggca
cgacaacggctaaatctcagtcatatggatcccaaaacctttgcggacgtaaacagcagc
ggattagcgtcgcgtattgtggaataccagcgggaccgtagcactggtggccgcggtctg
caacgcagcatctcctataataatatttataatccacttactcagccacgccgttgtagc
atagcttcatcgcctctatcccataagcccaacctgccatcagtgtccataacacgtatg
gcgccgcctgagcgaagcttctactgtggcaacacattgcccagcttgctgcgctcgaat
tcgctggttggcgtggagaaaaaaagtgaccagcagctgtcgagagagaatcgtccaatt
atgcatccacctccgctgcagcacgaaagcgaacccacgcgcagtgtccttgaggagctg
aaggagatatcacgcaagcgcatcaatagcggcgaaatacaacctaacgattacactagt
aaaaagagctgtaatcgcttaactgactatgtggatcatcatttacaccagcagcaccaa
ccgcagcagcatcagttatccatgctgcaatctcagtcgggtttcaagcgacagcgtgaa
ttgactgttacagtaccacgccgtttgcatcatacggccatagcgctgcctcaccaacat
caacatcacactttacatatgtctgcacatcattttcctgagaggatttctccacagcag
tcaccggagcagcaggccaagcgccgtaattgcagctacagcaatgacatcgcaagctca
ttaagctccagtcagctgcatagcaataagcggaagctatatgacatgcgttcagctagc
aacacgtccgcactcaacgacaatgccagcaacggcagcaacaacaatagctcacctgaa
acttcgccgcgcccacaggtggcaaagatacagcgaagtcaggcggctacaacagatcta
catttagagaatttgactaggacgcagagcacgccgatcactccactgccagctactcca
gcccagcgcgcggcgtccgctcccttagtagaggccaagtacgaccagaaacccaaattg
acattgttcaatgcacaacaacgacaaccgcaacagaagcagcagcagcaagaaccacca
gagccccaacaacaacaacaacaacacacgcaacagcaggttgacttggatagtcccgat
gtggatgccaacgaatatgcgggcatacagtttgtgaggcccaaacaggatcaatcactt
gtcaccagcaaaaactcccatttggagcgtacacagaaaacgaagctggctttgatgttg
agtagtctgcggggtgaaatctttcaagatgaaacgtcagctgatgaagcagatacttcc
acaaccacatcatctgtcgcaccgacaacaaaaaatacaaatcaagcaacaaacacaaat
gtaacaacgaacactgcatcgacgaaaccgactatactggcgactgctaccgtatcagcc
gcccccgctcaaagtgtatctacaacaataactgaaacagaagcacggacgacaacaacg
tcggcaacaacaatgtctgcactaacaccggcgccaactaccgccagcaatagcacattg
tctgtgctaccaggaaaatcgaccgaaaatgcaacaattggaacaggtgctgtgctagga
tttacattgccaacagcaacagagaagccagcaactacaacaacagcagaatctacacct
gtgttaacgtttacgaattcgaagacgacagctacaaccacaaccggatcgactgggtcg
cctgcatttacctttggcaagccagcagcggcagcagatgcaaaacagactccagcacca
acagaaacacttgcaacaacagcaacaccagcaacaaaggatccagcgaaaacaccattt
acatttggcactggcgcaaataatgcacaagcaacaggagcaggattgggcgcgcaagca
gcagcagcaactgcagtacagccagcgccatcagcacctctttcgtttaactttgggaag
cctgcatcaggtgcggcaacaagtagtacgttaattacaacatcagcaactgcgccaaca
acaacagcagcaagcacttccgttttcagttttggcacagctccagctacaactacagca
gcaaccagcaacaatcctctcatatttggcagcagcaacagtaacagtgaaacaggagca
acaattgttactacagctgcgccagcagcatctcagcccaaggaaccgtcgccttttggc
agcagcagcagcaatagcaacagctttgccatcggctttaaatctcctgcaacaccagca
gctgcagtaacagccgcaccatccgcgccagcaatatttagtttcggcaaaactccagcc
gctcctgcagctcctgtcgtattcggtagctcaacagcaacaacaacaacaacagcagca
acagcacagcctgcatttaactttggtggcacagcaactgctactgattctgcttctgcc
gctagtgcaactacctcaaataccaatgcagtttcagccgcaacaccagcagcaaacaac
tcgaatatatttgcctttggcggtgacagcaagcccacggttaaagccacgccttttacg
ctgcccaacaaaagcgacagcaacaatatatttagctttggcgctggcggcgatggagca
aaaatggcagcaacaccagccactggagcaaaagctacagtgcccagcgcctttaatttt
ggtggatcagcttctgctgcaccagtgggcggtgcaccagctacaaatgcattcagtttc
agtgcaccaaataagtcaacgcccttattcggagccagcaatgcaacagaaagcaaacca
tttacatttggtgccactgagagcacgcaacagcagcagcagcaacagcagcaacagcag
cagcagcagcagcaacagcagcaacagcagcagcagcaacaacagcaacaacagcagcag
cagcaacaacaacagcagcaacagcagacaacaccagcagtgggcggcttttcattttca
gctgtgattccaaaaagcgaatctacaaatttgtttaaatcgccattagccgtcggagcc
ggtggagtgaagccaagctttaattttggaggcaacacaacgttaggaacagcagcagca
actccagcgggcgcagccacgtcaggcaacggctttggtggctttgcggcaccggcaccg
gcaccggcagcagcaccagcgccttctgctgccaacaatcagaaactgtttacgtttggg
agcagtgccactcccagcaatggagcaaatcaaagcggaaacttgttcgccagcgcagtg
tccgctgtacagaaccagcagcagactaagcctggtggcttttcttttggcgctagcaac
gcggctaacagcagcaacgcaaccaatggaaatgccaatgcgccgtttgcttttggtggc
atcacatcgccgcagggcagcggggtcaatgcggccaataaaccgtttacatttggcaac
ccagcgccgtctataaatggctcagcgccttttacctttggtagcggcgttaatgctcct
tccacgccgacatcagctccgggcatgcctggccagcagatgaatcgctttgcaccgccc
accactccggaaaaccgacccatacgacgcgccacgcgacggctgcaaaagtag

DBGET integrated database retrieval system