KEGG   Drosophila mojavensis: Dmoj_GI23664Help
Entry
Dmoj_GI23664      CDS       T01062                                 

Definition
GI23664 gene product from transcript GI23664-RA
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
dmo  Drosophila mojavensis
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dmoj_GI23664
Enzymes [BR:dmo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     Dmoj_GI23664
Glycosyltransferases [BR:dmo01003]
 Polysaccharide
  Storage polysaccharide
   Dmoj_GI23664
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 709 aa AA seqDB search
MRRQMSYRFEDQDASPMAVRMNRRFSRVESGADLKDYFDRGDIASRENRWNFEVAWEVAN
KVGGIYTVIRSKAYVSTEEMGEQLCMMGPYKEQCARTEMEEMEFPRGNPLLDAVNALRSR
GYKIHTGRWLVDGNPQLILFDIGSAAWKLDQFKLEMWEKCNIGVPHLDIETNDAIILGFM
IAEFLEEFRNFAIAYSQNNELSAPRIVAHFHEWQAGVGLIVLRTRLVEIATVFTTHATLL
GRYLCAGNTDFYNNLDKFAVDEEAGKRQIYHRYCLERGATHLAHVFTTVSEITGYEAEHL
LKRKPDIITPNGLNVKKFSAIHEFQNLHAVAKEKINEFVRGHFYGHIDFDLDKTLYFFIA
GRYEFGNKGADIFIESLARLNAMLKHEKPDTTVVAFLIFPTKTNNFNVDSLRGHAVIKQL
RDTINNVQQAVGKRMFDTCLKGHIPGPDELLQKDDLVKIKRCMYAMQRDSMPPVTTHNVA
DDWNDPVLSSIRRCQLFNSVHDRVKMVFHPEFLTSTNPLFGIDYEEFVRGCHLGVFPSYY
EPWGYTPAECTVMGIPSVTTNLSGFGCFMQEHISDPKSYGIYIVDRRYIGLENSVQQLTN
FMMEFSRLNRRQRIIQRNRTERLSDLLDWRTLGIYYRQARVKALQAVYPDYVDESTLYGS
RNNLIFSRPHSEPPSPSSSRHTTPAPSVHGSDEEDSVDEETELKELGMK
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atgcggcgccagatgtcttatcgttttgaagatcaagatgcttcacctatggccgtgcgg
atgaatcgtcgattttctcgagtggagtccggcgcagacctgaaggactacttcgatcgc
ggcgatattgcatcgcgagagaatcgctggaacttcgaagtcgcatgggaggtggccaac
aaagtgggcggcatttacacagtgatacgctccaaggcgtatgtgtccaccgaggagatg
ggcgagcagctgtgcatgatgggtccctataaggagcagtgtgcacgcactgaaatggaa
gaaatggagtttccccgtggcaacccgcttttggatgcggtcaacgcattgcgctctaga
ggctataaaattcacaccggtcgctggctcgtcgatgggaatcctcagctgatactgttt
gacattggctctgccgcatggaagctggatcagtttaagcttgagatgtgggagaagtgc
aacattggcgtgccccatttagatattgagacgaacgatgccatcattttgggcttcatg
attgccgagtttctcgaggagttccgcaactttgccatcgcctactcccaaaacaatgag
ctcagtgcaccgcgcatcgttgctcactttcatgagtggcaagccggcgtaggcttgatt
gtgttgcgaacacgactcgttgagatcgccaccgtgttcaccacacatgccacgcttctg
ggtcgatatttatgcgccggcaacaccgatttctacaacaatctggacaagtttgcggtg
gacgaggaggcaggcaagcgtcaaatctatcatcggtattgcctggagcgtggtgccacg
cacctggcccacgtcttcacaaccgtatcggagatcacgggatatgaggccgagcatctg
ctcaagcgcaaacctgatataatcacgcccaatggcttgaacgtgaaaaagttctcggcc
attcatgagttccagaatttgcatgccgttgccaaggaaaagatcaatgagttcgtgcgc
ggtcatttctatggccacatagatttcgatttggacaagacgctgtacttcttcattgca
ggccgctatgagtttggtaataagggcgctgacatattcattgagtcgctggctcgcctc
aacgcgatgttgaagcacgagaaaccggacaccactgtggtggccttccttatctttccc
accaagacaaacaactttaatgtcgactcactgcgtggccatgctgtgatcaagcagttg
cgtgacaccatcaacaatgttcagcaggcagtgggcaagcggatgttcgatacatgcctt
aagggtcacatacccggccccgatgagctactgcaaaaggatgatctggttaagatcaag
cgttgcatgtatgctatgcaacgtgattcgatgccgccagtgaccacgcacaatgtggct
gatgattggaacgatccggtgctgtcctcgatccggcgctgtcagcttttcaactcggtt
cacgatcgcgtcaaaatggtcttccatccggagtttctgacttcaacaaatccgcttttc
ggcatcgactacgaggaatttgtacgcggctgtcatttgggcgttttcccatcgtactac
gagccgtggggctatacgccagccgagtgtaccgtcatgggcataccaagtgtaaccaca
aatctgtctggtttcggttgcttcatgcaggaacacatcagcgacccaaaatcttatggc
atatacattgtcgatcgtcgttatattggactagagaacagcgtgcagcagctgacgaat
ttcatgatggagttctcccgcttaaatcgtcgccagcgcattattcagcgcaatcgcaca
gagcgcctcagcgatttgcttgattggcgtacactgggcatttattacagacaggctagg
gtgaaggctttgcaggctgtctaccctgattatgtggacgaaagcaccttgtatggctca
cgcaacaatctaatcttctctcgtccacacagcgagccgccaagtcctagttcatcgcgg
cataccacacccgcgccttcggtgcacggctccgatgaggaggactctgtggatgaggaa
actgagttgaaggaactgggaatgaagtaa

DBGET integrated database retrieval system