KEGG   Drosophila mojavensis: Dmoj_GI23723Help
Entry
Dmoj_GI23723      CDS       T01062                                 

Definition
GI23723 gene product from transcript GI23723-RA
Orthology
K14459  
hexosaminidase [EC:3.2.1.52]
Organism
dmo  Drosophila mojavensis
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Dmoj_GI23723
Enzymes [BR:dmo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Dmoj_GI23723
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 703 aa AA seqDB search
MHSNLLIFIWRRKLSVLLLASAVVLLGLWTWAILDDTTKTLPAFAQQTSQQAADEANYQH
VHIIQKLIAQANRVLRAERQKDNAERPSPVQRLLGNVRFVRPTQAKKAPLPVADSYLFEQ
ERLKILEQQQRQRNAGMDELNANAEDDRMMSSAERQTQYEHELQRMGVPVVAGIGPDGPR
APAERLVHLDLKGAPPKLSFLKQLLPVLRALGATGLLIEYEDMFPYSGNLQPLAARNAYK
EAELKDFLESAWVEYGLSIMPLVQTFGHMEYALKLAEFEQLRELPESPQSICPSQPQSMA
LLEHMLTQVIELHMRPSDNATSSTTQLPIKFTHLHIGCDEVQRMGECSLCRQRLRSELFL
SHVISLAHFVRRRWPQLNVVIWDDQLRDISLSELQNSQIGSYVEPMVWVYASDIYHFIQP
QLWNTYAKVFPSAWAASAYKGAFGESLLVPPLQQHLENNIRWLAVIAKEGGRFAKGLRGL
ALTGWQRYDHFAVLCELLPVGMPSLMTSLSTVAKGYFSINPRDNELLRVLRCVFQPDSRR
SGHPWLELHPNAHYSQLFAVCSYPGHLVFKYALRLYDKLAEVRNYLQQTREHSAWLSDYN
VRHNFSSPLRVQELTVRTPQLVEELRAMAREAQQLLWEVYDEHTVAEFVEQHIYPSINAL
HQQLASGQTLLQRRTWQQRPLPLSLELQQDMGLVTTMDQQQEH
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgcactcaaatttgctgatatttatttggcgccgcaaactttcagtactgctgctggca
tcagctgttgttttgcttggactctggacgtgggccatactggatgataccaccaagacc
ctgccagccttcgcacaacagacttcgcaacaggccgctgatgaggccaactatcagcac
gttcatatcatccagaagctgatagcccaagcgaatcgggttttgcgtgccgagcgccaa
aaggacaacgcggagcgtccctctccggtgcagcgtctgcttggcaacgttcgcttcgtg
cgtccaactcaggcaaaaaaggcgccgctgcccgtcgccgacagctatctgttcgagcag
gagcgcctgaagattctggagcagcagcagcggcagcgcaacgcaggcatggacgaactc
aatgccaacgcggaggacgatcgcatgatgagctcagcagagcgtcagactcaatacgag
cacgagctgcagcgcatgggtgtgcccgtggtggctggcattggcccggatgggccacgt
gctccggccgagcgactggtgcatctggatctcaaaggtgccccacccaagctgagcttt
ctgaagcaactcctgcccgtgctgcgggccttgggcgccactgggctgctcattgagtac
gaggacatgtttccctacagcggcaatctgcagccgctggccgcgcgcaacgcatataaa
gaagctgaactaaaggactttctggagtccgcatgggtagagtatggacttagtataatg
ccgcttgtgcaaacatttggacacatggagtatgcactgaagctggccgaattcgagcag
ttacgtgagctgcccgagagcccgcaatccatttgccccagccaaccgcagagcatggcg
ctgctggaacacatgctcacccaggtgattgagctgcatatgcgaccctccgacaatgcc
acgtcctcgactactcagctgcccatcaagttcacacatttgcatattggatgcgatgag
gtgcagcgcatgggggagtgttcactctgtcgccagcgactgcgcagtgaactgttcctg
tcccacgtgattagcctggctcactttgtgcggcgtcgctggccgcagctgaacgtcgtc
atctgggatgatcagctgcgtgacataagtctcagcgagctgcagaactctcagatcggc
agctatgtggagcccatggtgtgggtatatgccagcgatatataccactttatacagccc
cagctatggaatacgtatgccaaggtgttccccagcgcatgggcggcatccgcctacaaa
ggcgcctttggggagagtctgctggtgccgccactgcagcagcatctggagaacaacata
cgctggctggcggtgatagctaaggagggtgggcgctttgccaaaggtctgcgggggttg
gcactcaccggctggcagcgctacgaccattttgccgtactctgtgagctgctgcctgtg
ggcatgcccagtctgatgacatccctgtccacagtcgcaaagggctatttcagcatcaat
ccccgggacaacgagctgttgcgtgtgctgcgttgcgtcttccagccggacagccggcgc
tcaggacatccctggctggagctgcacccgaatgcccattatagtcaattgtttgctgtg
tgcagctatccaggtcacctggtcttcaagtatgcgcttcgcctgtacgacaaactggcc
gaggtgcgcaactacttgcagcagacacgggagcacagtgcctggctctcggactacaat
gtgaggcacaactttagttcaccgctgcgggtgcaggaactgacggtacgcacgccccag
ctggtggaagagctgcgcgctatggcacgcgaggctcagcagctgctgtgggaagtgtat
gatgagcacacggtggcagaattcgtggagcagcacatttatccaagcatcaatgcgctg
catcaacaacttgctagtgggcagacgctgttgcagcggcgtacctggcagcaacggccg
ctgccattgagcctagagctgcagcaggacatgggactggtaaccacaatggatcagcag
caggagcattga

DBGET integrated database retrieval system