KEGG   Drosophila mojavensis: Dmoj_GI23751Help
Entry
Dmoj_GI23751      CDS       T01062                                 

Definition
GI23751 gene product from transcript GI23751-RA
Orthology
K11307  
histone acetyltransferase MYST2 [EC:2.3.1.48]
Organism
dmo  Drosophila mojavensis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 824 aa AA seqDB search
MESGSSSSSTSGSSSSSGSSSCTDTGSSSDTDSSSSAVAGPEEKPQPAKTQPAAVRRKAT
VTPAENEKAKTAGNHSALSSASSKVRSVVAASNQRNGALSSDDDDDDDEPPAKKNPRTMS
NNVASAAARRKPSTGAPAKQAASGAAGSSKAPQTAKATAQSQRNGDNKRPSLSSSSMSTD
DSHKDAKNGRKVPLKLASTATAVRAKQIRAKALQAKTSSASNSNNKNGPTAAAAAAAARR
GKSRSSDGSDDSDSGSGSETSSISESEGTDSTNSYSSQPATGKSNAKGKRVAAGAGDSEE
ERKDKANPMRKLTRSLSMRRSKQQQLKPGSESESDADLDQDDDKQRVLSKSPAKKPPTAH
IGLNSKCKVKKEMNSMKSRPVSPAVQLEKKCPIEGCDSSGHLSGNLDRHFLPEACPIFHN
MSASECKERANERKLRNEMRLKMPINIVSAPGNQNNNLKSLTPEQRDFLAKIRESRSNFR
PMSNSLNDKVKIEKDCTDEDREPNLAGLVPDYDLQLFREAQALASERIEDELKDLPVGKG
IKYISMGKYKMKVWYQSPYPDDAARLPKMYICEFCLRYQKSETGIKRHAQKCVWRHPPGD
EIYRKGKLQVWQVDGKRYKQYCQHLCLLAKFFLDHKTLYYDVEPFLFYIMTLADVDGCHI
VGYFSKHIPFLQEKNSFYNVSCILTLPPYQRKGYGRLLIDFSYLLTRVEGKIGSPEKPLS
DLGLISYRSYWKDVLLDYLCNRSGNTICIKDVSQEMAIYSYDIVSTLQALGMMKYWKGKH
IVLKKQDVLDEYEERVKRRGTFPKIDDSCLRWQPFIPAQPSASP
NT seq 2475 nt NT seq  +upstreamnt  +downstreamnt
atggaatctggcagcagttcaagctcgacgtcgggcagcagctcatcaagtggctcatcc
agctgcaccgatacgggcagctcgtcggacaccgactcgagcagttcggcagtcgccggt
cccgaggaaaagccacagcctgcaaagacacaaccagccgctgtgcgtcgcaaggcgaca
gtgacgccggcagagaatgagaaggcgaaaacggcgggcaaccacagcgctctgagctct
gcctccagcaaggtgcgctctgtggtggcggccagcaatcagcgcaacggtgcactatcc
agcgacgatgatgacgacgacgacgagccgccagcgaagaagaatccgcgcaccatgagc
aacaacgtagcatcagcggccgcccgccgcaaaccgtcaacaggagcgccggccaagcag
gcagcgagcggagcagccggtagcagcaaagcgccgcagactgccaaagccacggcccaa
tcgcagcgcaatggggacaacaagcgaccgtcactaagctcctcctccatgagcacggat
gactcgcacaaggatgcgaaaaacggacgcaaagtgccactcaagctggccagcactgcg
accgctgtgcgagccaagcaaatacgcgccaaggcgctgcaggccaaaacgagtagcgcc
agcaacagcaacaacaagaatggaccgactgcagctgcagctgctgctgcggccaggcgc
gggaagagccgcagcagtgatggcagcgatgattcggatagtggctcaggctcagagacc
agctccattagcgagtcggaaggcacggactcaaccaactcgtacagctctcagccggcg
acgggcaaatcgaatgccaagggcaagcgtgttgctgctggggctggcgacagcgaggag
gagcgcaaggataaggcgaatcccatgcgcaagctgacgcgttcgctgagcatgcgccgg
tccaagcagcagcagctgaagccgggcagcgagagcgaatctgatgcggatctcgatcag
gatgacgacaagcagcgcgtgctctccaagagtccggccaaaaagccgcccacagcccac
atcgggctcaacagcaaatgcaaggtgaagaaggagatgaactcaatgaagtcgcgaccc
gtctcgccggccgttcagctggagaagaagtgccccatcgaaggctgtgattcgtctggc
catttgagcggcaatttggatcgccatttcctgcctgaggcctgccccatcttccacaac
atgtccgcctcggagtgcaaggagcgcgcaaacgaacgcaagctgcgcaacgagatgcgc
ctcaagatgcccatcaacattgtcagcgcgccgggcaatcagaataacaatctcaagtcc
ctgacgcccgagcagcgtgatttcctggccaaaatacgcgaatcacgctccaacttccgg
cccatgagtaactccttaaacgacaaggtgaagatagaaaaagactgcacggacgaagat
cgtgaaccgaatctcgctggcctggtgcccgactacgatttgcagctgtttcgcgaggcc
caggctctggcctccgagcgcatcgaggacgagctcaaagatttgcccgttggcaagggc
atcaaatacatcagcatgggcaaatacaaaatgaaggtgtggtatcagtcgccctatcca
gatgacgccgcccgcctgcccaagatgtacatctgtgagttctgcctgcgctatcagaaa
tccgagacgggcatcaagcgacacgcccagaaatgcgtctggcggcatccgcccggcgat
gagatctatcgcaagggtaaactccaggtgtggcaggtggatggcaaacgatataagcaa
tactgccaacacctgtgtctgctggccaagttcttcctcgaccacaagacgctctactat
gacgtggagccgtttctcttttacatcatgacactggcagatgtcgatggatgtcacatt
gtgggctacttcagcaagcatattccatttctgcaggagaagaactcattttataacgtc
tcctgcattctgacactgcctccatatcagcgcaagggctacggcaggttgctcatcgat
ttcagctatctgctaacccgcgtcgaaggcaaaattggttcgccggagaagccactctcg
gacctgggtctcatatcatatcgctcatattggaaggatgtgcttttggactatctctgc
aatcgttccggcaatacgatatgcatcaaagatgtttctcaggaaatggccatctattcg
tatgatattgtgagcacactccaggcgctgggcatgatgaagtactggaaaggcaaacat
atagtgctcaaaaagcaggatgtgctggatgagtatgaggagcgagtgaagcgccggggt
acgtttcccaaaatcgacgactcctgcctgcgctggcagccctttataccggcacagccg
agcgcctcaccttaa

DBGET integrated database retrieval system