KEGG   Drosophila mojavensis: Dmoj_GI23773Help
Entry
Dmoj_GI23773      CDS       T01062                                 

Definition
GI23773 gene product from transcript GI23773-RA
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
dmo  Drosophila mojavensis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dmoj_GI23773
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dmoj_GI23773
   00020 Citrate cycle (TCA cycle)
    Dmoj_GI23773
   00620 Pyruvate metabolism
    Dmoj_GI23773
Enzymes [BR:dmo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Dmoj_GI23773
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 514 aa AA seqDB search
MLRTIAATRNELGALRLILLRARPVRYGSNYGVRALSTAGHQLPIRSSLHRKPILSRSHL
LPTWSYNFARAYADLPDHIRVPLPALSPTMDRGSIVGWEKKEGDKLNEGDLLCEIETDKA
TMGFETPEEGYLAKIVVPGGTKDVPVGKLVCIIVPDEGSIAAFKDFVDSGGPAAPAAAAP
APPPPPPPPPAAAPAPAAPAPAPAPAAAPSPPPAAAPAAAPAPAAAPSGGRVYASPMAKK
LAETKQLRLQGKGTGVHGSLKSGDLAAAPPPKPAPKPAPKSDARFKDIPLTTMRSVIAKR
LLESKQNLPHYYVTVHCQVDKLMKFRAHINKKYEKEGARVSVNDLIIKAVATACRKVPEA
NSAWMDTFIRQYEDVDVSVAVSTDKGLITPIIFGADRKGVLEISKNVKELAGKARDNKLQ
PHEFQGGTISVSNLGMFGVNQFCAVINPPQSCILAIGTTTKQLVLDPDSNKGFKEVNMLT
VTLSADHRVVDGAVAAVWLKHFRDFVEDPAAMIV
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgctacgcactatcgctgcaacacgaaacgaattgggcgccttgcgactcatcttactc
cgagctcgaccggtgcgatatggttcgaactatggagtccgggccttgagcactgctggc
catcagctgccaatcaggtcgtcactgcatagaaaaccgatcctcagtcgaagccatcta
ctgccgacatggagctacaactttgcccgcgcctacgccgatctgccggatcatatacgc
gtgccgctgccagcactgtcaccaaccatggaccgtggctcgatagtgggctgggaaaag
aaagaaggcgacaagctgaacgagggtgatctgctgtgcgaaattgaaacagataaagct
accatgggtttcgagacgcccgaggagggctatctggccaagattgtggtgcctggtggg
acaaaggatgtgccagttggcaagctggtgtgcatcattgttcccgatgagggcagcatt
gctgctttcaaggatttcgttgacagtggtggccccgctgcgcccgcagctgccgcacca
gcacccccaccaccaccaccaccaccaccagcagcagctccagctccagcagcaccagcc
ccagccccagccccagctgccgcaccatcaccaccaccagcagccgcgccagcagcagcc
cccgcgccggctgcagcaccaagcggcggtcgtgtctacgccagccccatggccaagaag
ttagcggaaacaaaacagctccgtctgcaaggcaaaggtaccggcgtccatggctcactt
aaatctggtgatcttgcagccgcaccgccaccaaagcccgcacccaaaccagcccccaag
tccgatgcgcgtttcaaggacatcccattgacgacgatgcgctcagtcattgccaagcga
ctgctagagtccaagcagaatctgcctcactactacgtaaccgttcattgccaggtggac
aagttgatgaagttccgcgcacacataaataagaagtacgagaaggagggcgcacgcgtc
tccgtcaacgatttgataatcaaggccgtggcgactgcctgtcgcaaggtgcctgaagcg
aactccgcttggatggacacgttcatccggcaatacgaagatgtggatgtttctgtcgca
gtgtcgaccgataagggactcatcacgcccatcatctttggcgctgaccgcaagggagtg
ctagaaatctcgaagaatgtcaaggaactggcaggcaaggcacgcgacaacaagctgcag
ccgcatgaattccagggcggcaccatctccgtgtccaatttgggcatgtttggtgttaat
caattctgtgccgtcatcaaccctcctcaatcctgcatcttagccattggcacaacaacg
aaacagcttgtgttggatccggacagcaacaagggtttcaaggaggtgaacatgctaacc
gtcacgctgagcgccgatcacagagtggtcgatggcgctgtagccgccgtttggctcaaa
catttcagagatttcgtggaggatccggctgcaatgatagtgtaa

DBGET integrated database retrieval system