KEGG   Drosophila mojavensis: Dmoj_GI23773Help
Entry
Dmoj_GI23773      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
dmo  Drosophila mojavensis
Pathway
dmo00010  Glycolysis / Gluconeogenesis
dmo00020  Citrate cycle (TCA cycle)
dmo00620  Pyruvate metabolism
dmo01100  Metabolic pathways
dmo01200  Carbon metabolism
Module
dmo_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dmoj_GI23773
   00020 Citrate cycle (TCA cycle)
    Dmoj_GI23773
   00620 Pyruvate metabolism
    Dmoj_GI23773
Enzymes [BR:dmo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Dmoj_GI23773
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding YbaB_DNA_bd
Motif
Other DBs
NCBI-GeneID: 6577232
NCBI-ProteinID: XP_002003201
FlyBase: FBgn0146498
UniProt: B4KKB2
Position
Unknown
AA seq 514 aa AA seqDB search
MLRTIAATRNELGALRLILLRARPVRYGSNYGVRALSTAGHQLPIRSSLHRKPILSRSHL
LPTWSYNFARAYADLPDHIRVPLPALSPTMDRGSIVGWEKKEGDKLNEGDLLCEIETDKA
TMGFETPEEGYLAKIVVPGGTKDVPVGKLVCIIVPDEGSIAAFKDFVDSGGPAAPAAAAP
APPPPPPPPPAAAPAPAAPAPAPAPAAAPSPPPAAAPAAAPAPAAAPSGGRVYASPMAKK
LAETKQLRLQGKGTGVHGSLKSGDLAAAPPPKPAPKPAPKSDARFKDIPLTTMRSVIAKR
LLESKQNLPHYYVTVHCQVDKLMKFRAHINKKYEKEGARVSVNDLIIKAVATACRKVPEA
NSAWMDTFIRQYEDVDVSVAVSTDKGLITPIIFGADRKGVLEISKNVKELAGKARDNKLQ
PHEFQGGTISVSNLGMFGVNQFCAVINPPQSCILAIGTTTKQLVLDPDSNKGFKEVNMLT
VTLSADHRVVDGAVAAVWLKHFRDFVEDPAAMIV
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgctacgcactatcgctgcaacacgaaacgaattgggcgccttgcgactcatcttactc
cgagctcgaccggtgcgatatggttcgaactatggagtccgggccttgagcactgctggc
catcagctgccaatcaggtcgtcactgcatagaaaaccgatcctcagtcgaagccatcta
ctgccgacatggagctacaactttgcccgcgcctacgccgatctgccggatcatatacgc
gtgccgctgccagcactgtcaccaaccatggaccgtggctcgatagtgggctgggaaaag
aaagaaggcgacaagctgaacgagggtgatctgctgtgcgaaattgaaacagataaagct
accatgggtttcgagacgcccgaggagggctatctggccaagattgtggtgcctggtggg
acaaaggatgtgccagttggcaagctggtgtgcatcattgttcccgatgagggcagcatt
gctgctttcaaggatttcgttgacagtggtggccccgctgcgcccgcagctgccgcacca
gcacccccaccaccaccaccaccaccaccagcagcagctccagctccagcagcaccagcc
ccagccccagccccagctgccgcaccatcaccaccaccagcagccgcgccagcagcagcc
cccgcgccggctgcagcaccaagcggcggtcgtgtctacgccagccccatggccaagaag
ttagcggaaacaaaacagctccgtctgcaaggcaaaggtaccggcgtccatggctcactt
aaatctggtgatcttgcagccgcaccgccaccaaagcccgcacccaaaccagcccccaag
tccgatgcgcgtttcaaggacatcccattgacgacgatgcgctcagtcattgccaagcga
ctgctagagtccaagcagaatctgcctcactactacgtaaccgttcattgccaggtggac
aagttgatgaagttccgcgcacacataaataagaagtacgagaaggagggcgcacgcgtc
tccgtcaacgatttgataatcaaggccgtggcgactgcctgtcgcaaggtgcctgaagcg
aactccgcttggatggacacgttcatccggcaatacgaagatgtggatgtttctgtcgca
gtgtcgaccgataagggactcatcacgcccatcatctttggcgctgaccgcaagggagtg
ctagaaatctcgaagaatgtcaaggaactggcaggcaaggcacgcgacaacaagctgcag
ccgcatgaattccagggcggcaccatctccgtgtccaatttgggcatgtttggtgttaat
caattctgtgccgtcatcaaccctcctcaatcctgcatcttagccattggcacaacaacg
aaacagcttgtgttggatccggacagcaacaagggtttcaaggaggtgaacatgctaacc
gtcacgctgagcgccgatcacagagtggtcgatggcgctgtagccgccgtttggctcaaa
catttcagagatttcgtggaggatccggctgcaatgatagtgtaa

DBGET integrated database retrieval system