KEGG   Drosophila mojavensis: Dmoj_GI23973Help
Entry
Dmoj_GI23973      CDS       T01062                                 

Definition
GI23973 gene product from transcript GI23973-RA
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
dmo  Drosophila mojavensis
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Peroxisome
Class
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:dmo00260]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:dmo00330]
Metabolism; Metabolism of other amino acids; D-Arginine and D-ornithine metabolism [PATH:dmo00472]
Metabolism; Biosynthesis of other secondary metabolites; Penicillin and cephalosporin biosynthesis
Cellular Processes; Transport and catabolism; Peroxisome [PATH:dmo04146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 341 aa AA seqDB search
MLRVAVIGAGVNGVASAIKILEHYQDEKKLNVQVTILSELFTPNTTGDGSAGLWGPFLLG
GTDESKVHKWSRDMHLFLEQIWLSEDAGEAGVCLVPCVRLSSDSNVIVGDFWRDIVYGAV
ELTAEQLEVYNKGRDVKFTSGMSFVTYTSEPIKLLPYLMKRFVRRGGQVEQRKITDLESF
VRESSYDVIVNCTGLGSRQLLNDDDVYSVRGQVSRVRANWVFTAILDESDDGNYIIPNTE
SVVLGGTHQERDYNTDVCAKDKRFIIDGCRSLLPGLKHSEHLFDWVGLRPGRVQLRLEAE
RRGNKLLIHNYGHGGSGVTLCWGCADDVLNLLLAARVKAKL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgctgagagtagctgttatcggggcgggtgtgaacggtgttgcgagtgccatcaaaata
ttggagcactatcaggatgagaagaagctaaatgtgcaggtgaccatattgtcggagcta
ttcacgcccaatacgacgggcgacggatcggcgggtctatggggaccctttctgttgggc
ggcacagatgagtctaaagttcacaagtggtcaagggatatgcacctattcctggaacag
atttggctaagcgaagatgcgggcgaggcaggtgtttgtctggtgccctgcgtgcgcctc
agctcagattcgaatgtcatcgttggcgatttctggcgtgatattgtctacggagctgta
gaactaacagctgaacaactggaagtttacaacaagggcagagacgtcaaattcactagc
ggcatgtcctttgttacttacacctcggaacccatcaagctgctgccttacctgatgaaa
cgctttgtgcgccgaggcggccaagttgagcagcgaaaaatcacagatctcgagagtttt
gtcagagagtcctcctacgatgtgatcgtcaactgcaccggccttggctccaggcagctg
ctgaacgacgatgacgtctattcggtacgtggccaagttagccgcgtcagggccaattgg
gtgttcaccgcgatcctagatgaaagcgatgatggcaactacatcataccaaacaccgag
tctgtggtgcttggtggcactcaccaggagcgggactacaataccgatgtctgtgcgaag
gataagcgcttcatcatcgacggctgtcgcagcctgctgccaggcctcaagcactcggag
catttgttcgattgggttgggctgcggccgggtcgcgtccagctgcgcctggaggcggag
cggcgtggcaacaagctgctcatacacaactatggacacggcggcagcggagtcaccctc
tgctggggctgtgccgacgatgtcctcaacctgttgctagctgccagagtcaaagccaag
ctgtag

DBGET integrated database retrieval system