KEGG   Drosophila mojavensis: Dmoj_GI23973Help
Entry
Dmoj_GI23973      CDS       T01062                                 

Definition
GI23973 gene product from transcript GI23973-RA
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
dmo  Drosophila mojavensis
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Peroxisome
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dmoj_GI23973
   00330 Arginine and proline metabolism
    Dmoj_GI23973
  Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    Dmoj_GI23973
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    Dmoj_GI23973
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    Dmoj_GI23973
Enzymes [BR:dmo01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     Dmoj_GI23973
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 341 aa AA seqDB search
MLRVAVIGAGVNGVASAIKILEHYQDEKKLNVQVTILSELFTPNTTGDGSAGLWGPFLLG
GTDESKVHKWSRDMHLFLEQIWLSEDAGEAGVCLVPCVRLSSDSNVIVGDFWRDIVYGAV
ELTAEQLEVYNKGRDVKFTSGMSFVTYTSEPIKLLPYLMKRFVRRGGQVEQRKITDLESF
VRESSYDVIVNCTGLGSRQLLNDDDVYSVRGQVSRVRANWVFTAILDESDDGNYIIPNTE
SVVLGGTHQERDYNTDVCAKDKRFIIDGCRSLLPGLKHSEHLFDWVGLRPGRVQLRLEAE
RRGNKLLIHNYGHGGSGVTLCWGCADDVLNLLLAARVKAKL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgctgagagtagctgttatcggggcgggtgtgaacggtgttgcgagtgccatcaaaata
ttggagcactatcaggatgagaagaagctaaatgtgcaggtgaccatattgtcggagcta
ttcacgcccaatacgacgggcgacggatcggcgggtctatggggaccctttctgttgggc
ggcacagatgagtctaaagttcacaagtggtcaagggatatgcacctattcctggaacag
atttggctaagcgaagatgcgggcgaggcaggtgtttgtctggtgccctgcgtgcgcctc
agctcagattcgaatgtcatcgttggcgatttctggcgtgatattgtctacggagctgta
gaactaacagctgaacaactggaagtttacaacaagggcagagacgtcaaattcactagc
ggcatgtcctttgttacttacacctcggaacccatcaagctgctgccttacctgatgaaa
cgctttgtgcgccgaggcggccaagttgagcagcgaaaaatcacagatctcgagagtttt
gtcagagagtcctcctacgatgtgatcgtcaactgcaccggccttggctccaggcagctg
ctgaacgacgatgacgtctattcggtacgtggccaagttagccgcgtcagggccaattgg
gtgttcaccgcgatcctagatgaaagcgatgatggcaactacatcataccaaacaccgag
tctgtggtgcttggtggcactcaccaggagcgggactacaataccgatgtctgtgcgaag
gataagcgcttcatcatcgacggctgtcgcagcctgctgccaggcctcaagcactcggag
catttgttcgattgggttgggctgcggccgggtcgcgtccagctgcgcctggaggcggag
cggcgtggcaacaagctgctcatacacaactatggacacggcggcagcggagtcaccctc
tgctggggctgtgccgacgatgtcctcaacctgttgctagctgccagagtcaaagccaag
ctgtag

DBGET integrated database retrieval system