KEGG   Drosophila mojavensis: Dmoj_GI24156Help
Entry
Dmoj_GI24156      CDS       T01062                                 

Definition
GI24156 gene product from transcript GI24156-RA
Orthology
K11252  
histone H2B
Organism
dmo  Drosophila mojavensis
Brite
Exosome [BR:dmo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dmoj_GI24156
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 123 aa AA seqDB search
MPPKTSGKAAKKAGKAQKNITKNDKKKKRKRKESYAIYIYKVLKQVHPDTGISSKAMSIM
NSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYT
SSK
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgccgcctaaaacaagtggaaaggcagccaaaaaggctggtaaggcccagaagaatatt
accaagaatgataagaagaagaagcgcaagaggaaggaaagttatgccatctatatttac
aaagtgctaaagcaggtccatcctgacactggaatctcgtcgaaagcaatgagcatcatg
aacagcttcgtgaacgacatttttgagcgtattgctgctgaggcctctcgtttagcacac
tacaacaaacgttcaacgattaccagtcgggaaatccaaactgcagtccgtcttctgttg
cccggagagttggccaagcacgctgtcagtgaaggaacaaaggcagtaaccaagtacact
agctccaagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system