KEGG   Drosophila mojavensis: Dmoj_GI24158Help
Entry
Dmoj_GI24158      CDS       T01062                                 

Definition
GI24158 gene product from transcript GI24158-RA
Orthology
K11252  
histone H2B
Organism
dmo  Drosophila mojavensis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 123 aa AA seqDB search
MPPKTSGKAAKKAGKAQKNITKNDKKKKRKRKESYAIYIYKVLKQVHPDTGISSKAMSIM
NSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYT
SSK
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgccgcctaaaacaagtggaaaggcagccaaaaaggctggtaaggcccagaagaatatt
accaagaatgataagaagaagaagcgcaagaggaaggaaagttatgccatctatatttac
aaagtgctaaagcaggtccatcctgacactggaatctcgtcgaaagcaatgagcatcatg
aacagcttcgtgaacgacatttttgagcgtattgctgctgaggcctctcgtttagcacac
tacaacaaacgttcaacgattaccagtcgggaaatccaaactgcagtccgtcttctgttg
cccggagagttggccaagcacgctgtcagtgaaggaacaaaggcagtaaccaagtacact
agctccaagtaa

DBGET integrated database retrieval system