KEGG   Drosophila mojavensis: Dmoj_GI24219Help
Entry
Dmoj_GI24219      CDS       T01062                                 

Definition
GI24219 gene product from transcript GI24219-RA
Orthology
K01049  
acetylcholinesterase [EC:3.1.1.7]
Organism
dmo  Drosophila mojavensis
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dmoj_GI24219
Enzymes [BR:dmo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     Dmoj_GI24219
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 636 aa AA seqDB search
MVSRLGLHSLLAALLVLAAQLSSVCGVIDRLVVQTSSGPVRGRSVTVQGREVHVYTGIPY
AKPPIDDLRFRKPVPAEPWHGVLDATRLSATCVQERYEYFPGFTGEEIWNPNTNVSEDCL
YINVWAPAKARLRHGRGANGAEHSGNKQTDTDHLIHNGNPQNTTNGLPILIWIYGGGFMT
GSATLDIYNADIMSAVGNVIVASFQYRVGAFGFLHLSPEMPPEFAEEAPGNVGLWDQALA
IRWLKDNAHAFGGNPEWMTLFGESAGSSSVNAQLMSPVTRGVVKRGMMQSGTMNAPWSHM
TSEKAVEIGKSLINDCNCNASMLKTNPAHVMTCMRAVDAKTISVQQWNSYSGILSFPSAP
TIDGAFLPADPMTLLKTADLKGYDILMGNVRDEGTYFLLYDFIDYFDKDDATALPRDKYL
EIMNNIFGKATQAEREAIIFQYTSWEGNPGYQNQQQIGRAVGDHFFTCPTNDYAQALAER
GASVHYYYFTHRTSTSLWGEWMGVLHGDEIEYFFGQPLNTSLQYRPVERELGKRMLNSVI
EFAKTGNPAPDGEEWPNFSKEDPVYYIFSTDDKIEKLARGPLAARCSFWNDYLPKVRSWA
GSECDSGSASITPRMQLLGLGLVLYIGALLRLKGVF
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atggtctctcggctgggcctgcactcgctgctcgccgcgctgctcgtgctggcggcgcag
ctgtccagcgtgtgcggcgtcatcgatcgcttggtggtgcagaccagctccggtccggtg
cgcggccgttccgtaacggtgcagggtcgcgaagtgcacgtctatacgggcataccctat
gccaagccgcctatcgatgatttgcgcttccgcaagccggtgccggctgagccctggcac
ggcgtactcgatgccacccgcctctcggccacctgcgtccaggagcgctatgaatacttt
ccgggcttcactggcgaggagatctggaatcccaataccaatgtatccgaggactgtttg
tatataaatgtttgggcgccagcgaaggcgcgtttgcgtcatgggcgtggcgccaacgga
gccgagcactcgggcaacaagcagaccgatacggatcatctcatacacaatggcaatcca
cagaacacgaccaacgggctgcccatattgatatggatctatggcggtggcttcatgacc
ggatcggccacgctggacatatacaatgcggacatcatgtccgccgtgggcaacgtgatc
gtggcctcgtttcagtatcgcgtgggcgcatttggctttctgcacctgtcgccggagatg
ccgccagagtttgccgaggaggcgcccggcaatgtgggtctgtgggatcaggcactggcc
atacgctggttgaaggacaacgcgcacgcctttggcggcaatcctgaatggatgacgctg
tttggcgagtcagccggctcgagttcggtgaatgcacagctcatgtcgccggtcaccagg
ggcgtggtcaagcgtggcatgatgcagtcgggcaccatgaatgcgccctggagccacatg
acatccgagaaggccgtcgagattggcaaatcgctgatcaacgactgcaactgcaatgca
tccatgctgaagacaaatcccgcccacgtgatgacctgcatgcgtgccgtggatgccaag
accatatcagtgcagcagtggaactcctactcgggcatactcagcttcccatcggcgccg
accattgatggcgccttcctgcccgctgatccgatgactctgctgaagacagccgatctg
aaaggttacgatatactcatgggcaatgtcagagatgagggcacctatttcttgctgtac
gatttcattgattactttgataaggatgatgccacagcgttgccacgtgacaagtatctg
gagattatgaacaatatatttggtaaggccacgcaggcggagcgcgaggctattatattc
cagtacaccagctgggagggcaatccgggctatcagaatcaacagcaaattggacgcgca
gtcggggatcatttcttcacgtgccccaccaacgactatgcacaggcgctggccgagcga
ggtgcctccgtgcattactactactttacacaccgcaccagcacctcgctgtggggcgag
tggatgggcgtgctgcacggcgatgagattgagtacttctttggtcagccgctgaacaca
tctctgcaatatcgacctgtggagcgggagctgggcaagcgtatgctaaattcggtcatt
gagttcgccaagacgggcaatccggcaccggatggcgaggaatggccgaacttttcaaag
gaggatcccgtgtattatatcttcagcacagacgacaaaattgagaaattggctcgtggc
ccgctagcagcgcgttgctccttctggaatgattatttgcctaaagttcgaagttgggca
ggctccgagtgcgattcgggcagtgcttccataacgccccgcatgcagctgcttggactg
ggactcgtgctctacataggcgccctgctgcggctgaaaggagttttctaa

DBGET integrated database retrieval system