KEGG   Drosophila mojavensis: Dmoj_GI24222Help
Entry
Dmoj_GI24222      CDS       T01062                                 

Definition
GI24222 gene product from transcript GI24222-RA
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
dmo  Drosophila mojavensis
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:dmo00230]
Metabolism; Biosynthesis of other secondary metabolites; Caffeine metabolism [PATH:dmo00232]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 335 aa AA seqDB search
MLATPLRHLASLKLPTTVVKDQSQLYEITNKGYGKDAVKVMHINRKGRVHSIQELEVGTH
LKLYSSKDYMQGNNSDVVATDSQKNTVYLLAKKHGIESPEKFALLLASHFLKTYPHVEQA
HVHVEAYPWQRMEQEHCQVKDGDSQSNCRRQLHNHAFIFTPTAMHYCDVIMSQNDPKPTV
MSGIKDLRVLKTTQSSFVNFVDDEFRTLADQHDRIFSTVVECSWEYSETQSVDFLRAWQT
VKDIVLRNFAGDPSVGIPSPSVQHTLYLSEKQVLDVLPQVSVISMTMPNKHYFNFDTKPF
QKLVPGENNEVFIPIDKPHGTIYAQLSRKDLKSHL
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgcttgcaactcctttgcgccatctggccagcctgaagctacccaccacggtggtaaag
gaccagtcccagctgtacgagattaccaacaagggctacggcaaggatgccgtcaaagtg
atgcacatcaatcgcaaggggcgagtgcacagcatccaggagttggaggtgggcacacat
ctgaaactctacagcagtaaggactatatgcagggcaataactcggatgtggtggccacc
gattcgcagaagaatacagtctacctgctggccaagaagcatggcatcgagagtcccgaa
aagttcgctctgctcctggccagtcattttctgaaaacctatcctcacgtggagcaggct
cacgtgcatgtcgaggcgtatccatggcagcgcatggaacaggaacactgtcaagtgaag
gacggcgattcacagtcgaattgcagacgccagctacacaaccacgccttcatctttacg
cccacggcgatgcattactgcgatgtgattatgtcccaaaatgatcccaagccaactgtc
atgagtggcatcaaggacctgcgcgtcctgaagacgacccaatcttcattcgtgaacttc
gtggacgacgagttccgcacgctggcagatcagcacgatcgcatcttcagcaccgtcgtg
gaatgctcctgggagtactcagagacgcagtccgtcgactttctgcgcgcctggcagacg
gtcaaggacattgtgctgaggaactttgccggcgatcccagcgtgggcatcccctcgccc
tcggtccagcacacgctgtatctcagcgagaaacaggtgctggacgtactgccgcaagtg
tctgtgatctcgatgaccatgcccaacaagcactacttcaacttcgacacgaaacccttt
caaaagctggtgccaggcgagaacaacgaggtcttcataccgatcgacaagccccatggc
accatctatgctcagctctcgcgcaaggacctcaaaagtcatctgtaa

DBGET integrated database retrieval system