KEGG   Drosophila mojavensis: Dmoj_GI24225Help
Entry
Dmoj_GI24225      CDS       T01062                                 

Definition
GI24225 gene product from transcript GI24225-RA
Orthology
K17610  
calcineurin B homologous protein 1
Organism
dmo  Drosophila mojavensis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 189 aa AA seqDB search
MGNKSSLFLRHEEIAQIQNETGFTPNQIERLYSRFTSLDRNDCGTLSREDLMRIPELAIN
PLCERIVHSFFAESSDDRVNFRQFMNVLAHFRPLRDNKQSKLNSREEKLKFAFKMYDLDD
DGVISRDELLSILHMMVGANISQDQLVSIAERTILEADLCCQGKISFEDFCKALERTDVD
QKMSIRFLN
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgggcaataaatcttcgctgtttctgcggcacgaggagatagcacagatacaaaatgaa
actggctttacacccaatcagattgagcgtctttactcgcgcttcacctcgctggatcgc
aatgactgcggcacgctctcccgcgaggatctgatgcgcatacccgagctggcaatcaat
ccgctctgcgagcgcatcgtgcactctttcttcgccgagagctccgacgatcgggtgaac
tttcgccagttcatgaatgtgttggctcacttccgaccgctgcgggacaacaagcagagc
aagctgaacagccgtgaggagaagctaaagttcgccttcaagatgtacgacctggacgac
gatggtgtcatcagccgggacgagctgctctcgatcctccacatgatggtcggcgcgaac
atcagtcaagatcaattggtcagcattgcagagcgcacaattctggaggcggatctgtgc
tgtcagggcaagatctcgttcgaggacttctgcaaggcgctggaacggaccgatgtcgac
cagaagatgtccattcgattcctcaactaa

DBGET integrated database retrieval system