KEGG   Drosophila mojavensis: Dmoj_GI24275Help
Entry
Dmoj_GI24275      CDS       T01062                                 

Definition
GI24275 gene product from transcript GI24275-RA
Orthology
K13278  
60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
dmo  Drosophila mojavensis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 569 aa AA seqDB search
MRMEDGSLQNVSGELIKRLREDTSFHDKDYKLPFERGENSPLVLPWIHDTQYRVIYDIVE
FTQLMNSSSIHLDDWVHLAKEVEDNYERYDGFIILHGRDTMAFTASALAFMLENLTKPVI
ITGSQLPIIELRTDGRNNFVTSLLIAGNFDLPEVILVFGHKVLRGCRSTKRANNSFHAFD
SPNAPALGTCSVNIDIDNKNIFQPNNSGPFTVFTEMEPNVSLLRLYPGISVEVMQSFFNP
PMKGVVIQSYGIGNIPTNDHKLSDVISDAISRGIVVVNMTQCSNGKVMPQHLTSNWMELG
VVCAYDMTQEAALTKLSYVLGKKEWDVDVKKEKMEQSLRGELTIPTSAKSVEVDFIEGVA
RNLQVSKDKKRGEMCATFFPALVEAAIREDNPHKLTNLKQYGANLSDTNTEGRTALHLAC
FLGKKKCVGTLLKDGSPVDLTDRFNRTPLHEAIDADNHELIEILLKKGATLTEGPLELAQ
KLRSLAEDGNVDRLESYRLAGADLEVADGSGRTALHHASQLGEINVVKYLLPYYRNPSAK
DCLGLCAIQYAKAGNFCNIVALLSADKNC
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgcggatggaagacgggtctttgcaaaacgttagcggagaactcattaaacgactgcgc
gaagataccagctttcacgacaaagactacaaactgcccttcgagcgaggcgaaaactcg
cctttggtcctgccatggattcatgacacgcaatatcgtgtgatttatgatatagtcgag
tttacgcaattgatgaactccagctctatacatttggatgattgggtgcacttggccaaa
gaagtggaagataattacgaacgctacgatggcttcatcatactgcacggcagagacacc
atggcgtttactgcctcagctctcgcatttatgctggagaatcttaccaagcccgttata
ataaccggcagccagttgcccatcattgagttgcgcacagatggccggaacaattttgtt
acatcgctgctgatcgctggcaactttgatctgcccgaggtgattctggtctttggccac
aaagtgttgcggggctgccgcagcactaagagagcaaacaactcctttcacgcattcgat
tcgcccaatgccccggcactgggcacatgtagcgttaatatcgacatcgacaacaaaaac
atatttcagccgaacaattcaggtccgttcacggtattcactgaaatggagccgaatgtc
agcctgctacgtttgtatccaggcatctcagtcgaggtgatgcagagcttcttcaatccc
cctatgaagggcgttgtcatacagagctacggcatcggcaatataccaaccaatgatcat
aagctgtcggatgtcatctccgatgcgatttctcgtggtattgtggttgtgaacatgacg
caatgttccaatggcaaagtgatgccccaacatttaacgtccaattggatggaattgggc
gtggtctgtgcctacgatatgactcaggaggcagcattaaccaaattgtcctatgtgctg
ggaaaaaaggagtgggacgtggacgttaagaaggaaaagatggaacaaagtttgcgcggc
gaattaaccataccaacgtcagctaaaagcgttgaagtcgatttcatcgaaggcgtggca
cgaaatctccaagtctccaaagacaagaaacgcggtgaaatgtgtgccacattctttcca
gcgctcgtcgaagcagccatccgagaggacaatccacataaactgacaaatctgaagcaa
tacggcgccaatctgagcgatacgaacacagaggggcggacggctttgcatctggcctgt
tttctgggcaagaaaaagtgcgtcggaaccctactaaaagatggtagcccagtggatttg
accgatcgattcaatcgaacgccactgcacgaggccatcgatgcggacaatcatgaactg
attgagatattgctaaagaagggcgccaccctcacagaaggcccattggaattggcccag
aagctgcgctcactcgctgaagatgggaatgtcgatcgcttggagtcatatcgcttggcc
ggcgccgatctcgaggtggcggatggcagcggtcgcacagcgctccaccatgccagccag
ctgggcgagataaatgtggttaagtatctgttgccctactatcgcaatcccagtgccaag
gactgtcttggcctgtgtgccatacaatatgctaaagcaggcaatttttgtaacattgtc
gccctgctgtctgcagacaaaaactgttaa

DBGET integrated database retrieval system