KEGG   Drosophila mojavensis: Dmoj_GI24325Help
Entry
Dmoj_GI24325      CDS       T01062                                 

Definition
GI24325 gene product from transcript GI24325-RA
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
dmo  Drosophila mojavensis
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:dmo01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:dmo01040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 469 aa AA seqDB search
MGHLSTSERVCSTTPMASTGEGSPPLLARRAKLSSEAQARRSEDSSPESMPRGKQQQQPQ
QQQQQQQKSVPLSAEPAVKNIPKHLIDYIPKDQINMEEYVRNFKGDNILGWRFNAPLKWD
KVIQISLLHLIALFCLVTYPIQEMRFYTILWALFMGGVAGFGVTAGAHRFWTHRSYKANA
LLRSLLMISYSVAGQNTMYDWVRDHRVHHKYSETDADPHNANRGFFFSHVGWLMMLKHPE
VLRRGRQIDMSDIVSDPVIQFHQKYFYVLKVMLCFVLPTLVPVYCWNDSWYHAFVTQCLF
RYVFSLNFTWSVNSAAHLWGSRPYDKRIMPSENIYVSIISMGEGWHNYHHVFPWDYKAAE
LGYKVNFTTMVLDIFHKLGWAYDMKQPSKELVRRTLEKFGDGSHESQRGKGAAQFGAVPT
QMVGHIHYAEVPDPELEYDAESSSTESAKLDENENEGERQKKATKKLAA
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgggtcacctgtccacatcggagcgcgtgtgcagcaccacgcccatggccagcacaggt
gagggcagcccgccgctgctggcgcgccgtgccaagctgagcagcgaggcgcaggcgcgc
cgcagcgaggactcatcgcccgagtcgatgccgcgcggcaagcagcagcagcagccgcag
caacaacaacagcaacagcagaagtcggtgccactgtcagcagagccggcggtcaagaat
attccaaagcatctgatcgactacatacccaaggatcaaatcaacatggaggaatacgtt
cgcaatttcaagggcgacaatatcctgggctggcgcttcaacgcgcccctcaaatgggac
aaggtcatacagatctccttgctgcatctgatcgccctcttctgtctggtcacctatccg
atacaagaaatgcggttttacacgattctttgggctctattcatgggcggcgttgctgga
tttggcgtgacagcaggtgctcatcgcttctggacacatcgcagctataaggcgaacgcg
ctcctcagaagccttttgatgatcagctactcagtagctggtcagaacaccatgtacgat
tgggtgcgagatcatcgagtgcatcacaagtactcggaaacggacgccgatccgcataat
gcgaatcgcggcttcttcttctcgcacgttggctggctaatgatgctgaagcatccggaa
gtgttgcgtcgtggccgtcagatcgacatgagcgacatcgtttcggatcccgtcatacaa
ttccatcagaagtacttctatgtgctgaaggtgatgctctgcttcgtgctgcccacgctg
gtgccggtctactgctggaacgactcctggtaccacgccttcgtgacccagtgtctgttc
cgttacgtgttcagcctgaacttcacctggtcggtgaatagtgccgcccatctgtggggc
tcgcgtccatatgacaagcgcatcatgccgagcgagaacatctacgtgtccatcatatcc
atgggcgagggctggcacaactaccatcacgtcttcccctgggactacaaagcagctgag
ctgggctacaaggtcaacttcaccaccatggtgctggacatattccacaaactaggctgg
gcgtacgacatgaagcagccgtccaaggagctggtgcgtcgcactctcgagaagtttggc
gacgggtcacatgaatcgcaacgtggcaagggagcagctcaatttggtgccgtgcccacc
caaatggttgggcatatccactacgccgaggtgccggatcccgagctggagtacgatgcc
gagtcgagcagcactgagagcgccaagctcgacgagaatgagaacgagggcgagcgacag
aagaaggcgacaaaaaagttggccgcttaa

DBGET integrated database retrieval system