KEGG   Drosophila mojavensis: Dmoj_GI24497Help
Entry
Dmoj_GI24497      CDS       T01062                                 

Definition
GI24497 gene product from transcript GI24497-RA
Orthology
K11404  
histone deacetylase 3 [EC:3.5.1.98]
Organism
dmo  Drosophila mojavensis
Brite
Enzymes [BR:dmo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     Dmoj_GI24497
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 436 aa AA seqDB search
MSDRRVSYFYNADVGNFHYGAGHPMKPQRLAVTHSLVMNYGLHKKMKIYRPYKASAQDML
RFHSDEYIAYLQQVTPQNIQCNSVAYTKYLAHFSVGEDCPVFDGLFDFCAMYTGASLEGA
QKLNHNHSDICINWSGGLHHAKKFEASGFCYVNDIVIGILELLKYNPRVLYIDIDVHHGD
GVQEAFYLTDRVMTASFHKYGNYFFPGTGDMYEIGAESGRYYSVNVPLKEGIDDHSYFQV
FKPIISAIMEFYRPTAIVLQCGADSLAGDRLGCFSLSTRGHGECVKFVRTLNVPTLVVGG
GGYTLRNVARCWTHETSLLVDQEISNDLPPTEYYDFFAPDFTLHPDVNSRQDNANSKQYM
ELIVKHVYENLKMCQNSPSVQMVQTPRDVDFEELRMKEETDPDVRMSQADEDKMVEAKNE
FYDGEHDQDKPDSMES
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatagacgagtttcatacttttacaatgccgatgtggggaatttccactatgga
gcggggcatccaatgaagccgcaacgcttagccgtcactcacagcctggtcatgaactac
ggcttgcacaaaaagatgaaaatctacagaccatacaaagctagtgcacaggatatgctg
cggtttcatagtgacgaatacatcgcctacctccagcaggttactccacagaatattcaa
tgcaattccgttgcctatactaagtatttggctcactttagcgtgggtgaggactgtccc
gtcttcgatggactttttgacttttgcgccatgtacacaggcgcctccctcgagggcgca
cagaaactaaaccacaaccacagcgacatatgtatcaattggtctggtggtctgcatcat
gccaagaaattcgaggcctcgggtttctgctacgtcaacgatattgtaattggcatacta
gagctgctgaaatataatccgcgagttctctacatcgacattgatgtgcatcatggcgat
ggagtacaggaagcattctatttaacggatcgcgtgatgacagcatcctttcacaaatat
ggcaattacttctttccgggcactggggatatgtatgagattggcgccgagtctggtcgt
tattacagcgttaatgttcctctcaaagagggaattgatgatcacagctattttcaagtg
ttcaaaccaataatttcagcgattatggaattctatcggcctacagcaattgtgctgcaa
tgcggcgccgattccttggctggagatcgtctcggatgtttctcgcttagtactcgtggc
catggagagtgcgtgaagttcgtcagaacgctaaatgtgcccacattagttgtgggcggc
ggcggttacactttacgaaacgttgcacgatgctggacgcacgaaacgtcgcttcttgtc
gatcaggagatttccaacgatttgcctccaacggagtactatgatttctttgcgccagat
ttcacattacatccggatgtaaattcacggcaggacaacgcaaattctaaacaatatatg
gagctgatcgtaaagcatgtatatgaaaacctgaaaatgtgtcagaactcgccaagtgtg
caaatggtgcaaacaccccgagacgttgatttcgaggagctgcgtatgaaagaggaaacg
gaccctgatgtgcgcatgtcacaggcggatgaggataaaatggttgaggcaaagaatgag
ttttacgatggcgaacatgatcaggacaaacccgactcaatggaaagttaa

DBGET integrated database retrieval system