KEGG   Drosophila mojavensis: Dmoj_GI24532Help
Entry
Dmoj_GI24532      CDS       T01062                                 

Definition
GI24532 gene product from transcript GI24532-RA
Orthology
K09186  
histone-lysine N-methyltransferase MLL1 [EC:2.1.1.43]
Organism
dmo  Drosophila mojavensis
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    Dmoj_GI24532
Enzymes [BR:dmo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     Dmoj_GI24532
Transcription factors [BR:dmo03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    Dmoj_GI24532
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 3756 aa AA seqDB search
MGRSKFPGKPSKSINRKRISVLQLEDDAAAAAASAAASTAATEQHQQGEQSAGSASREKG
NNCDNDDDDNAPSGATTSGNSSTSGGVAGATATEGGSSADNGSSGGNTTNGGNVNGGSHH
KNATAAAPLSAEVKECKNQGNNIEPNNCIGAGPDEAEDTNNDDEDDSGNDRKATAGVVSF
GPGLGALQRARKGGNKKFKNLNLARAEVMLPSTSKLKQQQQQQQQQLQLNCPSSSSSSSA
PTTTKATALAIAALASTTATTSTSTSSSASSMPGTSLAAAAGGGGGTAAGLLANPFANVE
TNVAEAPAAASAAASTATAAAGAGEDVAMLKASNEMGTEAGPEAAVAAGKSNGCSPSANA
VAGTSAAPGAPTATKQKKTVTFKNILETSDDKSVVKRFYNPDNRVPLVSIMKKDSMNRPL
TYCRGSEFIVRPSILSKILNKNSNIDKLNSLKFRSVHASASTAQESSSANLFGSGLSRAF
GAPMDDEDAVSGGVTFHKEEPQSRATEDNDDDGSESSDDIEDDEGIDDEEVEDKEEAKPE
KSAETTANMDEKDGDDRQLVVDKHFVLPKRSTRSSRIIKPNKRLLDMGGISSKKSTSDAV
SKPKPKNYFGLTDFASEMAASTSSASSSSSVALSQKLLKETFPSFGSTKLNSSFVMRQPR
LQFQTDKGGSFVGAKLPTASPSPALSSAISLANAVSFGSLNNANSAVSTSCAICSAPVNN
KNATLERKYGAIACDVCRKFNSRMTKVSKLSTPTQSAQQLQCKGANGGNCSIQSAKSQLK
NFKKLYKERCTACWLKKCITVFQLPSGHRSRLSAMLPANMREESAPKDDKSSELLSPTAN
MRFTAPTNSATSASSGTTIMWKSSAESAVNIIKSNPLAENNVTFGSTPLLRPAILEKPLF
LKIASDNKKPKELKVASTEAVALSPVPSTSEPSVAAPNKATRKAKQDKEKAKEQEGDKQL
SPSTRKVTDVNTSEIQKDDQQHPPAAAIGASIANSSAAQTNSTSATHSAMETAEAASTPT
SAAPDNLKRQRIDLKGPRVKHVCRSASIVLGQPLATFGDEEDELAAAETAPPATVPEANA
KKPKSPQTVQMIIDENDNCATCKPTTNETTAEAQPVAKAALEPKSGKSSAQTEAKKATTT
SASSKGKVTTRNATATVTSAASGLMPSKKQRNHEGSSTAGNQAAAPQSRRALAKEVNRLK
ALISIDFWENYDPAEVCQTGFGLIVTEPVAQRALCFLCGSTGLDPLIFCACCCEPYHQYC
VLDEYNLKHSSFEDTLMNSLLDTSSNACAISAATNTALNQLTQRLNWLCPRCTVCYTCNM
SSGSKVKCQKCQKNYHSTCLGTSKRLLGADRPLICVNCLKCKSCATTKVSKFVGNLPMCT
ACFKLRKKGNFCPICQKCYDDNDFDLKMMECGDCNQWVHSKCEGLSDEQYNLLSTLPESI
EFICKKCARRCDVSRQKADEWRQAVMEEFKSSLYSVLKLLSKSRQACALLKLSPRKKLRC
SCAAGGGKAQAQGKLQPKALQFTYNGLGSDGESQNSDDVYEFKEQLSSSNPKPSTPVPCT
CLQPSTQSQSFSLVDIKQKIANNAYVSLAEFNYDMSQVIQQSNCDELDIAYKELLSEQFP
WFQNETKACTDALEEDMFESCGYEELEESPSAYAEHNTATQPPSAGLLDIPLADVDDLGG
CAVKTRLDTRVCLFCRKSGEGLSGEEARLLYCGHDCWVHTNCAMWSAEVFEEIDGSLQNV
HSAVARGRMIKCTVCGNRGATVGCNVKSCGEHYHYPCARSIDCAFLTDKSMYCPVHARNA
LKANGSPGVTYETNFEVSRPVYVELDRKRKKLIEPAKVQFHIGSLEVRQLGSIVPRFSDS
FEALVPINFLCSRLYWSSKEPWKIVEYTVRTTIQNSYSSTLTLDAGRNFTVDHTNPNYSL
VQLGLAQIARWHSSLARSDLLETDWAEFPNSYVPPDENTEEEPQQNADLLPPEIKDAIFE
DLPHELLDGISMLDIFMYEDLGDKTELFAMSDQSKDGTTATSQATGGSVSICDDDTRNSN
SLSKQLELSNCWPASNPVEDAMLSATRSSNQAKQRNSEVLKKTATAQTRSWPKMDGSSVA
VFKRRKLSKNLPEGVLLSLNQRNKKEMATVAGITRRQSICGSSELLAEGNAAMRTKSFTW
SAAKRYFEKSESRDEAAKLKIMQMDGVDDSITEYRIIGSDGNLSTAQFTGQVKCERCQCT
YRNYDSFQRHLASCEPMSTSESESETTTGPSQLSAESLNELQKQAIAAATLGNTGGLNYL
QTSFPQVQNLATLGQFGVQGLQGLQALQLQAQSLGNGFFLSQPNATQATSNGNDDLQLYA
NSLQNLAANLGGGFALTQPTVNAQAQPQLIALSTNPDGTQQFIQIPQANGAAPQLLQTTA
PTAMPTTTYQTLQATNSDKKIVLPLRGTAKPLKTVATKAAQQATAAAKQKQLKSAQGVKP
IQAKLQPQQQQQQQQQQQQQQQQQQHQQQQPITVTAGTTQLLGQNLLQPQLLFQSNSQPQ
TSQLLLPQTQAQNIISFVTGDGSQNQPLQYISIPTANDYKSQQTTATPTFLTAPGGGATF
LQTDASGNLVLTTAPTNSGLQMLTGSLQAQPQVIGTLIQPQTLQLTTGGDGTQGATTQQP
LILGGATGGGATGLEFATTTPQVILATQPMYYGLETIVQNTVMSSQQFVSTAMPGVLSQN
ASFSATTTQVFQASKIEPIVDLPAGYVVLNNAVDAGSSTGWNTASVLQQSQSQTTEDATT
QLLQNAGFQFQTATPTTSAQQTMSDYVAPMVVTAKVPPVAQVKRNANATKANISMLSKVQ
PQPQQPQVVNKVLPTNVVTQQQQQQQQQQQQQQYQQHKQAAVQQQTGTTCGAPPSIASKP
LQKKTNLIRPIHKVEVKPKLMKPAPKLPTSAAAIQQQQQQQPSAVANQMPKVALLQQRLP
APLQQQQLQQQQQQLQPQQQQQQQLSVPQLLPTQQPIISIVNTSEPQATTQFVITPTQTQ
QQQPDLLINGNPTRLQHYTSNSLPTNVVNPLQLQQPIAVSTTNNSTTAAPQNSITINSRP
TNRVLPMQQRQEPAPLNCDAVVQSPTPPKPIDEPVIAAASTQKAVLKCYAQQEQKSPGYE
AELKTSTTLDSLVQTNSITTLQLQQQQQEPLYSEHIFEKQSEAQPQLEKPKANDLMLIDS
TSCQQQQQQQQEQQQQQQHMDIVSNGFQLTSNESCLLEKNGFHVEAVPMETDDHYDRLKN
GNGTEGLSQVDDADEEEEDDDDFSLKMATSACNDHEMSDSEEPAVKEKISKILDNLTNDD
CADSIATATTVEASAGYQQMVEDVLATTGAGSVATDDEAFTATAEETAAVEAAASYINEM
AEAHELQLKLQAGVELELKKPKLDLPQQPDAVQPNEMPTAAAPQQPPPVRDPKKISGPHL
LYEIQSEDGFTYKSSSIAEIWEKVFEAVQVARRAHGLTPLPEGPLADMSGVQMIGLKTNA
LKYLIEQLPGVEKCVKYTPKYHKRNGNVSTSAGAGHAVSGASGNSAALLGTGTDGQPIID
YGSDQEELQENAYECARCEPYSSRSEYDMFSWLASRHRKQPIQVFVQPSDNELVPRRGTG
SNLPMAMKYRTLKETYKDYVGVFRSHIHGRGLYCTKDIEAGEMVIEYAGELIRSTLTDKR
ERYYDSRGIGCYMFKIDDNLVVDATMRGNAARFINHSCEPNCYSKVVDILGHKHIIIFAL
RRIVQGEELTYDYKFPFEDEKIPCSCGSKRCRKYLN
NT seq 11271 nt NT seq  +upstreamnt  +downstreamnt
atgggccgctctaagttccccgggaaaccatccaagtcgatcaatcgtaaacggataagt
gtcctgcaattggaggatgatgcagcggcggcggcggctagcgctgcggctagcactgcg
gcaacagagcagcatcagcagggcgaacaaagcgccggctcagcgtcgcgggagaagggc
aacaattgtgataacgatgacgatgataatgcgccaagtggtgcgacgaccagcggaaac
agtagtacatccggaggagttgcgggtgccacagccaccgaaggtggcagcagcgcggac
aacgggtccagcgggggtaacacaacaaatggtggcaatgtaaatggaggcagtcaccac
aagaacgccacagctgcagccccactgtcggcagaggtcaaggaatgcaaaaatcaaggc
aacaatatcgagcccaacaactgcattggcgctgggcccgatgaggccgaggacacaaac
aacgatgacgaggatgacagtggcaatgacaggaaggcaacagccggcgttgtctctttt
gggcccggactcggtgcgttgcagcgtgcacgcaaaggaggcaataaaaaattcaaaaac
ttgaatctggccagagcggaggtgatgttaccctcaacgtcgaaactcaagcagcagcaa
caacaacaacaacagcaattgcaacttaattgcccttcatcgtcttcatcgtcatccgct
cctacgactacaaaggcgacggctttagcgattgctgcgctggcgtcgacgacggcaacg
acgtcaacgtcaacgtcgtcgtcggcgtcaagcatgcctgggacgtcactggcagcagct
gctgggggcgggggaggcactgctgctggccttctggcgaacccctttgccaacgtcgag
acaaacgtggcagaggcaccagccgctgcatcggcagccgcatcaacagcaacagcagca
gcaggcgctggcgaagatgttgcaatgctaaaggcttcaaacgaaatgggcactgaggcc
ggcccagaagccgctgtcgccgcaggcaaatcgaatgggtgcagtcccagcgccaatgcg
gtggccggcacgagtgccgccccaggggcccccacggcgaccaagcagaagaaaacggtc
accttcaagaatatactcgagaccagtgatgacaagtcggtggtgaagcgtttctacaat
ccggacaatcgggtgccgctcgtttcgatcatgaagaaggacagcatgaaccgaccgctc
acctattgccggggcagcgagttcattgtgcgtccctccatactgtccaagatactcaac
aagaactccaacatcgacaagctcaactcgctgaaatttcgctcagtgcatgcctcggca
tccaccgcacaggaatcgagctccgcgaatctttttggctctggtctgagtcgagccttt
ggcgcccccatggacgacgaggacgccgtttcgggtggtgtcacatttcacaaggaggag
ccgcagtccagagcaacggaagacaacgacgatgatggctccgaaagtagcgatgacatt
gaggacgatgagggcattgatgatgaagaagtggaggacaaggaagaggcgaagcccgag
aagagtgctgaaacaacagctaatatggatgaaaaggatggtgacgacaggcaactggtc
gtggataagcatttcgtgttgcccaaacgcagcacacgctcatctcgcatcataaagccc
aataagcgtctccttgatatgggcgggataagcagtaagaagagcaccagcgatgccgtt
agcaagcctaagccgaagaactattttgggctgacggactttgccagcgaaatggccgct
tcgacgtcgtcagcatcatcatcatcgtccgttgctttgagccagaagctgttgaaggaa
acgtttcctagctttggctcaacgaagctcaacagcagttttgtgatgcgccagccgcgc
ctgcagttccaaacggacaagggtgggtcgtttgtgggcgccaagctgcccacagcgtcg
ccatcgcctgcgttatccagtgccatttcgttagcaaatgctgtatcctttggctctctc
aataatgccaattcagctgtgagtacgtcatgcgccatttgctcagcgccagtgaacaac
aagaatgcgacgctggagcgaaaatatggcgcaattgcctgtgatgtttgtcggaagttc
aactcaagaatgacaaaggtatccaagctatcgacgccaacacagtcggctcagcaactg
cagtgcaagggcgcaaacggcggcaactgcagcatacaatcggccaagagccagctgaag
aacttcaagaagctctacaaggagcgctgcacggcttgttggcttaagaaatgcataacg
gtattccagctgccctcggggcatagaagccgcttgagtgccatgctgcccgccaatatg
cgcgaagagagcgcacccaaggacgacaaaagctcggagctgctttcgcccacggctaac
atgcgcttcacagcgccgacaaactccgccacgtctgcgagctccggcacgaccatcatg
tggaagtccagtgcggagtctgcagtgaacatcatcaagtcgaatcctctggcagagaat
aatgttacctttggcagcactccattgctccgacctgcaatactcgaaaagccgttgttc
ttaaagatagccagcgataacaaaaagccgaaagaattaaaagtcgcgtccacggaggcg
gttgctctaagtcccgtgcccagcaccagtgaaccatcagtggctgcgccaaataaagcc
acgcgcaaggccaagcaggacaaagagaaagcaaaggaacaggaaggcgataagcagctt
agtcccagtacaagaaaagtgactgacgtcaacacatcggagattcaaaaggatgatcaa
caacatccaccagcagcagcgattggagcgtccatcgccaactcttctgcagcccaaacg
aactccacttccgccacccacagtgcaatggagacggctgaggcagcctccacgccgaca
tcggcagcgccggataacttgaagcggcagcgcattgacctgaaggggccgcgtgtgaaa
cacgtgtgccgcagtgcatccatagttcttggtcagccgctagccacctttggcgacgag
gaagacgagctggcagcggcagaaacagcaccgccagcaactgtgccggaggccaacgcc
aagaagcccaagtcgccacagaccgtgcaaatgatcatcgatgagaacgacaactgtgcc
acctgcaagccaacgactaatgaaaccacagcggaagcccagccagttgctaaggctgcg
ctggaaccgaagagcggtaaatcaagtgcgcaaacagaggctaaaaaggcaacaactaca
tcggcatcctccaagggcaaagttactacgcgaaatgcgactgcaactgtgacatcagcg
gccagcggtctgatgcccagcaagaagcagcggaatcacgaggggagcagcacggctgga
aatcaggcggctgctccgcagagtcgtcgtgccctggctaaggaagtgaaccggctgaag
gcgttgatttcaatcgatttctgggagaactacgatccggccgaagtgtgtcaaacggga
tttggattgattgtcacagagccagtggcgcagcgtgctttatgctttctgtgcggctcg
acgggcctggatccgctcatcttttgcgcctgctgctgtgagccctaccatcagtattgt
gtgctggacgagtacaatctgaagcacagctcctttgaggatacgctgatgaacagcctg
ttagacacgtccagcaatgcctgcgccatttcagcggcaacgaatacggcgctgaatcag
ctgacgcagcgactcaactggctatgtccgcgctgcaccgtttgctatacgtgcaacatg
tcgtccgggtcgaaggtgaagtgtcagaagtgccagaagaactaccacagcacgtgcctg
ggcaccagcaagcgattgctgggtgcggatcggcccctaatctgcgtcaactgtttgaag
tgtaagtcctgcgccaccaccaaggtgtccaagttcgtgggcaatctgcccatgtgcacc
gcctgcttcaagctgcgcaagaagggcaacttctgccccatctgccaaaagtgctatgac
gacaacgacttcgacctgaagatgatggagtgcggcgactgcaaccagtgggtgcactcc
aagtgcgagggcctcagcgacgagcagtacaatctactgagcacgctgccggaatccatt
gagttcatatgcaagaagtgcgccaggcgctgcgatgtctcccgccaaaaagcggacgag
tggcgtcaggctgtcatggaggagttcaagtcgagcctgtacagcgtgctcaagttgctc
agcaagtcgcggcaagcgtgcgccttgctcaagctgagtccgcgcaagaaactccgttgc
agctgtgccgcaggaggaggcaaggctcaggctcaaggcaagctgcagcccaaggcgctg
cagttcacctacaacgggctgggcagcgatggcgagagccagaacagcgacgatgtgtac
gagttcaaggagcagctgagctcgtccaatccgaagccgtcgactccggtgccatgtacc
tgcctgcagccatcgacccaatcgcagtcgttcagcctcgtcgacattaagcagaagatc
gcgaacaatgcctatgtttcgctggcggagttcaattacgacatgagccaggtgatacag
cagagcaactgtgatgagctggacatagcctacaaggagctgctgagcgagcagtttccc
tggtttcagaacgagaccaaggcctgcacggatgcgctcgaggaggatatgtttgagtcg
tgcggctatgaggaactggaggagtctccgtccgcatatgccgagcacaatacagcaacg
cagccaccgagtgccggcctcctggacataccgttggccgatgtggacgatctgggtgga
tgtgcggtgaagacacgtctcgacacgcgcgtctgcctcttttgccgcaaaagcggtgag
ggcttatccggggaggaagcgcgtctactttactgtggtcacgactgttgggtgcacacg
aactgcgccatgtggtccgccgaggtgttcgaggagatcgacggctcgctgcagaatgtg
cacagcgcagtggcccgcggtcggatgatcaagtgcaccgtctgcggcaatcgaggcgcc
acagttggctgcaatgtcaagtcgtgcggcgagcactatcattatccctgtgcgcgaagc
atcgactgtgccttcctcaccgacaagtccatgtactgtccggttcatgctcgcaatgcg
ctcaaggcgaatggatccccgggcgttacctacgaaacgaactttgaggtctcgcgtccc
gtttacgtggagctggatcgcaagcgtaaaaagctgattgagcccgccaaggtgcaattc
cacattggatcgctcgaggtgcgacagctgggctccattgtgccgcgcttctccgactcc
ttcgaagccctagtaccgatcaatttcctgtgcagccggctgtattggtcctccaaggag
ccatggaagatcgttgagtacacggtacgcaccaccatacagaacagctactcgtccacg
ctgacactcgacgccgggcgaaacttcactgtggatcacaccaatccgaattattcgctg
gtgcagttgggtctggcgcagatagcgcgatggcacagcagtctggcgcgcagcgatctg
ctggagacggactgggccgagtttccgaattcgtatgtgccacccgatgagaacaccgag
gaggaaccgcaacagaatgcggatctattaccgccagagataaaggatgccatattcgag
gacttgccgcatgaactgctcgatggcatctccatgctggacatattcatgtacgaagat
ctgggcgacaagaccgaactgttcgccatgagcgaccagtccaaggacggcacaacggcc
acatcacaggcgacaggcggatcggtgagcatctgcgacgatgacacgcgcaactcaaat
agcctcagcaagcagctggagctcagcaattgctggccagccagcaatcccgttgaagat
gccatgctgtccgccacacgcagctccaaccaggcgaagcagcgaaacagcgaggtgctc
aagaaaacggccacggctcaaacgcgctcctggcccaagatggatggcagcagcgttgcg
gttttcaagcggcgcaagctctccaagaacctgcccgagggcgtgctcctcagtctcaat
caacgcaacaaaaaggaaatggccaccgtggccggcatcacgaggcgccagtcgatctgc
ggcagcagcgagctgctcgccgagggaaacgcagccatgcgcaccaagagctttacgtgg
agtgcagcgaagcgatatttcgaaaagagcgagtctcgcgacgaggctgccaaattgaag
attatgcaaatggatggcgtggacgactccataaccgagtatcggattattggcagcgat
ggcaacctgtcgacggcccagttcacggggcaggtgaagtgtgagcgctgccagtgcaca
tatcgcaactacgactccttccagcgacacttggccagctgtgagcccatgtccaccagc
gaatcggagtcggagaccacgacggggccctctcagctcagcgccgagagcctcaacgag
ctgcagaaacaggcaatcgccgcagccacgctgggcaacacgggcggactcaactatttg
cagacctcctttccgcaggtgcagaacctggccaccttgggccagttcggagtgcagggt
ctgcagggcttgcaggcgctacagctgcaggcgcagtctctgggcaatggcttctttctg
tcccagccaaatgccacacaggcgacgtccaatggcaacgatgatctgcagctctatgcg
aactcactgcagaatctggcggccaacctgggcggcggctttgccctgacacagccaacg
gttaacgcgcaggcgcaaccccagctgatagcgctctccacgaacccggatggaacgcag
cagttcatacagataccacaggccaatggagctgcgccacagctgctgcagacgactgcg
ccaacagccatgccaacgaccacataccaaacgctgcaggcgaccaacagcgataagaag
atcgtcctgccgctgcgtggcaccgccaagccgctcaagacggtggccacgaaagcggcg
cagcaggcaacagcagcggctaagcagaagcagctgaagtcagcgcaaggcgtcaagccc
attcaggcgaagctgcagccccagcagcagcagcagcagcagcagcaacaacaacaacaa
caacagcagcagcagcatcaacaacaacagcccatcacggtcaccgctggcaccacccag
ctgcttggtcagaatttgctgcagccccagctgctgtttcagagcaactcgcagccgcaa
acgtcgcagctgctgctgccgcaaacccaggcgcagaacatcatttcgtttgtgaccggg
gacggcagtcagaaccagccgctgcagtacatctcgataccgacggccaatgactataag
tcacagcagacgacggccacgcccacgttcctgactgcgccgggcggtggtgcgacattt
ctgcaaaccgatgcaagtgggaatctggtgctaaccaccgctccgaccaactcgggcctg
cagatgctcaccggatcgctgcaggcgcagccccaggtcatcggcacgctcatccagccg
cagacgctacagctaaccacggggggagatggaacgcagggtgcgacaacacagcagcca
ctcatactgggtggagcaactggcggtggtgccactgggctggaatttgccactacgacg
cctcaggtcatactggccacgcagcccatgtactacggcttggagacaatagtccagaac
acggtgatgtcttcgcagcagtttgtgtccacggccatgccgggtgtgcttagccagaat
gcaagtttctcggccacgacgacccaggtgttccaggccagcaagatcgagccaattgtc
gatctccccgctggctatgtggtgctcaacaatgcagtggatgcgggcagcagcaccggc
tggaatactgccagcgtgctgcagcagagccagtcccagacgacggaggacgccaccaca
cagttgctgcagaatgctggctttcagttccagaccgccacgcccacaacgtccgcacag
cagaccatgtcggactatgtggccccaatggtggttacggccaaggtgccgccggtggca
caagtgaagcgcaatgcaaacgcgacaaaggcaaacatctcgatgctcagcaaggtgcag
ccgcagccacagcagccccaagtggtcaacaaagtgctgcccaccaatgtcgttacacag
cagcagcaacagcagcaacagcaacaacaacagcaacagtatcagcagcacaagcaggca
gcggtgcagcagcagacgggcaccacgtgcggcgcaccacccagcatagcctcgaagcca
ctgcagaagaaaaccaacttgatcaggcccattcacaaggttgaggtgaagccaaagctt
atgaagccggcacccaagctacccacttcggcagctgcaattcaacaacagcagcagcag
cagccgtcagcggtggctaatcagatgcctaaggtggcgctgttacaacagcgcctgccc
gcgccactccagcaacagcaattacagcagcagcagcagcaactacagccgcagcagcaa
cagcagcagcagctatccgtgcctcaactgctgcccacacagcagccgatcatcagcata
gtgaacacatcagagccccaggcaaccacccagtttgtaattacgccgacgcagacgcag
cagcagcagccggatcttctcatcaatggcaatcctacgaggctgcagcactataccagc
aattcgttacccacgaatgtggtcaatcctctgcagctgcagcagccgatagctgttagc
accaccaacaacagcaccactgcggcgccgcagaacagcattacgataaatagccggccc
acgaatcgggtgctgcccatgcaacagcggcaggagccggcgccactgaactgcgacgcc
gtggtccagtcgccgacgccacccaagcccatagatgagccagtgattgcggccgcatcc
acgcagaaggcagtgctcaaatgctacgcgcagcaggagcagaaatctcctggctacgag
gcggaattgaagacgagcaccacattggatagtctggtgcagacgaattccataacgacg
ctgcagttgcagcagcagcaacaggagccgctctatagtgaacacatcttcgagaaacag
tcggaggcacagccacagctggagaaaccgaaagccaacgatctcatgctcattgactcc
acctcatgccaacagcaacagcagcagcaacaagaacaacaacaacagcaacagcatatg
gatatagttagtaatggctttcagctaacatctaacgagagctgcctgctggagaagaat
ggtttccatgtggaggctgtgcccatggagacggacgatcattatgacaggctgaagaac
ggcaacggaactgaggggctgagtcaagtggatgatgccgatgaggaggaggaagacgac
gatgactttagcttgaagatggcaacgtcggcatgcaatgatcacgaaatgtccgatagc
gaggagccggcggtaaaggagaagatcagcaagattctggacaacctgacaaacgatgat
tgtgccgattctatagccacggcaaccacagtcgaagcgagcgctggctatcagcaaatg
gtcgaggatgtgctggccacgactggcgccggttcagtggctacggatgacgaagctttc
acggccacagctgaggagacggctgcagtggaagcagcggccagctacatcaacgaaatg
gccgaggcccacgagctgcagctgaagctacaagcgggcgttgagctggagctgaagaaa
cccaaactcgacctgccacagcagccagatgccgtgcagcctaatgagatgcccacagcc
gctgccccacagcagccgccgccagtgcgcgaccccaagaagattagtggaccccatctg
ctgtacgagatacaaagcgaagacggcttcacctacaagtcgagctcgattgccgagata
tgggagaaggtgttcgaagctgtgcaggtggcacgacgagctcacggtctgacgcctctg
ccagaaggaccactggccgacatgagcggagtgcaaatgatcgggcttaagacgaacgcc
ctcaagtatctgatcgagcaactgccgggcgtcgagaagtgcgtcaagtacacgcccaag
tatcacaagcgtaacgggaacgtgtccacatctgccggagctgggcatgcggtcagcggg
gcgtctggcaacagtgcagcacttcttggcactggaacggatggccagccgattatagac
tacggctctgatcaggaggagctgcaggagaacgcatacgagtgtgcacgctgtgagccc
tatagcagtcgctcagaatacgacatgtttagctggctggcgtccaggcatcgcaagcag
cccatccaggtgtttgtgcagccttccgataacgaactggtgcccagacgcggaactgga
agcaatcttcccatggccatgaagtaccgtacgctgaaggagacctacaaggattacgtg
ggcgtcttccgctctcacatccatggacgtggtctctactgcactaaagatatcgaagcg
ggtgaaatggttatcgagtacgctggagaactgatacgctctacgctgacggacaagcgg
gagcgatattatgacagccgcggaattggctgctacatgttcaagattgacgacaatctc
gttgtggatgccacaatgcgtggcaatgcggcacgttttatcaatcactcttgtgagccg
aattgctactcgaaagtcgtcgatatacttggacacaagcacatcatcatcttcgccctg
cgtcgcatcgtgcagggcgaggagctgacctatgactacaaatttccattcgaggatgag
aaaattccctgttcatgcggctcaaagcgttgccgcaagtacttaaactag

DBGET integrated database retrieval system