KEGG   Drosophila mojavensis: Dmoj_GI24602Help
Entry
Dmoj_GI24602      CDS       T01062                                 

Definition
GI24602 gene product from transcript GI24602-RA
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
dmo  Drosophila mojavensis
Brite
Enzymes [BR:dmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     Dmoj_GI24602
Protein kinases [BR:dmo01001]
 Serine/threonine protein kinases: Other group
  TTK family
   Dmoj_GI24602
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 636 aa AA seqDB search
MTTPAPRHVRDLLAFGTDSEDESDASQVNKRKVEAFDNGNKENEDQPKAVRHQLVKENRP
AAPAAKVLFPRRRAELTMMDSDSDDEDNKNDHNLNCAILNDSFVLSPMHELTSSNTGIPS
KTPGTLRASDSNLSFLGRFGNMGINCSTSTNTAKSSPAQVEQEPQPMEMPTKKPAPPTLQ
IITEQRKAVSTKTPMRTSLAPSLKKQPKPETEFVTPQVCSLATRQNTRTQTTQKTRNELA
NEFRSQKVLFQTPMTVSRAAPFTSDSLSFSLCDTISESPDTPAQPPPRVEAPITGKSKKS
LESEFRHAEQEKPEVPLSVPAAPAATLPDKPEPASKSNVLQIKNHVYHIIRKLGCGGSSS
VYLARRKDTGQEFALKVVDLQADPVVVQGYLNETKLLEKLQGNVCVVSLYDYQLLRQESK
LYMVMEKGDCDLNKILQGFTTNLPLYNLMNILYQMLQAVNYIHQNGVIHSDLKPANFLMV
NGRLKLIDFGIASNIAVDSTSIIKFSQAGTFNYISPEALTDISSGSSPMRGSNQPKIKIS
TKSDVWSLGCILYLLLYQKTPFGHIRNINAKMSAIASPATSIEYPALPIYYPLMLVHMVK
NCLQLNPKKRPSCVDLLKYPFHMVIPLQNLQLESKR
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atgactacacctgccccacgccatgttagagatttgttagcatttggtacggattcagaa
gatgaatctgatgcgagtcaagtgaataagagaaaagtggaagcattcgacaatggcaac
aaagagaatgaagaccagcccaaagcagtacgccatcaactggtcaaggaaaacaggcct
gcagcacctgcagctaaggtcttgtttcccagacgccgagccgagttgacaatgatggac
tcggacagtgatgatgaggacaataagaacgatcataatttgaactgcgccattctcaac
gactcctttgtgctaagtcccatgcacgagctgaccagtagcaacacgggcattccttcc
aaaactccgggtactctgcgggcgagtgactcgaatttgtcgtttcttggtcggtttggg
aacatgggcatcaattgcagcaccagcactaacactgccaaatcgtcacctgcacaagtg
gaacaggaaccacaaccaatggagatgccaaccaagaaaccagcgcccccgacactgcaa
ataattacggagcaacgcaaggctgtgtctaccaaaacgccgatgcgcacttccctagcg
ccgtctctgaagaaacaacctaaaccagaaacggaattcgtaacgccgcaggtttgcagt
cttgccacaaggcaaaacacgcgcacacaaaccacacaaaagacccgcaatgagctggcc
aatgagtttcgctcacagaaggtgctcttccagacgcccatgacggtgagccgggctgcg
ccctttacaagcgacagccttagcttctccctatgcgacaccatcagtgagagtcccgat
acgcccgctcaaccaccgccaagggtagaagcccctatcaccggcaagtcgaaaaagtcc
ctcgaatctgagtttcgtcatgctgagcaggagaagcctgaagtgcccttgtcagtgccg
gctgctcccgctgctacgctgcctgacaagccggaaccagcctcaaaatcaaatgtgctc
caaatcaaaaaccatgtgtaccacataattaggaagctcggctgcggcggatcaagttcc
gtttatttagcacgacgcaaggatacgggccaggaattcgcgcttaaagtggttgatcta
caggccgatccggtagtggtgcagggctatctcaatgaaaccaagttgctcgaaaagctt
cagggcaatgtatgcgttgtgtcgctctatgactatcaactgttgcggcaagagtccaaa
ctgtatatggttatggagaagggcgactgtgacttgaacaagatcttacagggattcaca
accaacctaccgctttataatctgatgaacatactctaccaaatgctgcaggcagtcaac
tatatacaccagaatggagtaattcactccgatttgaaacctgccaacttcctcatggtt
aacggccggctgaagctcatagacttcggcattgccagcaacattgccgtggactcgacg
agcataattaagttttcacaggctggcacattcaactacatcagtccggaagcactcacg
gacatctccagcggatcgagtccaatgcgcggcagcaatcagcccaagataaagatttcc
acaaaatcggacgtttggtcgctcggctgcattttgtatctgctgctgtatcagaagacg
ccatttggtcacattaggaacatcaatgcaaagatgagcgcgatcgccagtcccgccaca
agcatcgagtatccggccttaccaatttactatccgctcatgttggtgcatatggtcaag
aactgcctacagctgaatccgaaaaagcggccctcgtgcgtggacctgcttaagtatcca
ttccatatggtaatacccttacagaatctacaattggaatccaagcgctga

DBGET integrated database retrieval system