KEGG   Drosophila mojavensis: Dmoj_GI24730Help
Entry
Dmoj_GI24730      CDS       T01062                                 

Definition
GI24730 gene product from transcript GI24730-RA
Orthology
K01360  
proprotein convertase subtilisin/kexin type 2 [EC:3.4.21.94]
Organism
dmo  Drosophila mojavensis
Brite
Enzymes [BR:dmo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.94  proprotein convertase 2
     Dmoj_GI24730
Peptidases [BR:dmo01002]
 Serine Peptidases
  Family S8: subtilisin family
   Dmoj_GI24730
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 645 aa AA seqDB search
MLALATLLPLAIAESESAARGHGGQPNHAVFTSSFLVRFRRGVDNDFAHKLADKYGFENL
GPLVGADGHEYHFKHKTLPHARSRRSLMHTRVLKSHPSVLTAVQQAGFRREKRGLRPAIP
AIHGLHYAATLGEPNTVDVEPTDPYFPLQWYLKNTGQNGGKVRLDLNVQAAWAQGITGKN
VTTAIMDDGVDYMHPDLKFNYNAEASYDFSSNDAFPYPRYTDDWFNSHGTRCAGEVAAAR
DNGICGVGVAYDSKIAGIRMLDQPYMTDLIEANSMGHEPHKIHIYSASWGPTDDGKTVDG
PRNATMRAIVQGVNEGRNGLGNIYVWASGDGGEEDDCNCDGYAASMWTISINSAINDGQN
AHYDESCSSTLASTFSNGAKDPNTGVATTDLYGKCTTTHSGTSAAAPEAAGVFALALEAN
PQLTWRDIQHLTVLTSKRNSLFDAKNRFYWTMNGVGLEFNHLFGFGVLDAGAMVTLAKQW
HSVPARYHCEAGEINKPQPIIMGRSLFWEIKTDACKGTDTEVNYLEHVQAVITANASRRG
DLELFLTSPMGTKSMILSRRANDDDHRDGFTKWPFMTTHSWGEYPQGVWKLEARFNSAQA
RLGHLVEWSLVLHGTKEAPYRTLKPSSPHSKLAIVKKAHEDKKMK
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgctggcgctggcgacgctcctgccgttggctatcgccgaatcggagtcagctgcccgt
ggccacggcggtcaacctaatcatgccgtcttcaccagctcatttctggtgcgcttccgt
cggggcgttgacaatgattttgcccacaagttggccgacaagtatggcttcgagaatctg
ggaccgctggtcggcgctgatggacatgagtatcacttcaagcacaagacattaccgcac
gctcgttcgcggcgcagcctgatgcacacgcgtgtcctcaagagtcatccctcggtgctc
acggccgttcaacaggcgggctttagacgcgaaaagcgcggtctgcgaccggcaattcct
gcaattcatggactgcactacgcagctacgctgggcgaaccgaacaccgttgatgtggag
ccgacggatccgtactttcccctgcaatggtatctgaaaaacaccggacagaacggcggc
aaagtgcgattggatctgaatgtacaggctgcctgggctcagggcattacgggcaagaac
gtgaccacggccatcatggatgacggcgtggactacatgcatccggatctgaaattcaat
tataacgccgaggcgagctacgactttagcagcaatgatgcattcccctatccgcggtac
acagacgactggtttaacagccatggcactcggtgtgctggcgaagtggctgctgccaga
gataatggaatttgcggcgtgggtgttgcttatgacagcaaaatcgcaggcatacgcatg
ctggaccagccctatatgacggacctaatcgaagccaactcaatgggacacgagccgcac
aaaatccacatatacagtgcctcctggggtcccacagatgatggcaagacggtggatggg
ccgcgcaatgccaccatgcgcgccattgtccagggtgtgaatgagggccgaaatggcttg
ggcaacatctatgtctgggcgtctggcgatggcggcgaggaggatgactgcaactgcgat
ggctatgccgcctccatgtggactatttccattaacagcgccatcaacgatggccagaat
gcgcactacgatgaaagctgcagctcgacgctggcatcgacgttcagcaatggtgccaag
gatccaaacactggggtcgccaccaccgacctatacggcaagtgcaccacgacccattcg
ggcaccagcgccgcggcacctgaggcagctggcgtctttgcattggcattggaagcgaac
cctcagctcacttggcgcgacatacagcatctgactgtgctgacatcgaaacgcaattcc
cttttcgatgccaagaaccgattctactggacaatgaacggcgtcgggctggagttcaat
cacctctttgggttcggtgtgctcgatgcgggcgccatggtgaccctggcgaagcagtgg
cactcggtgccagcacgctatcattgcgaggcgggcgagattaacaagccacagccaatc
ataatgggtcgctcgctgttttgggaaatcaaaactgatgcgtgcaagggcaccgatacg
gaagtgaactacttggagcacgtgcaggcagtcatcacggcaaatgcatcgcgacgcggc
gacctggagctcttcctcacctcccccatgggcaccaaatccatgattctgtcgcgacgc
gctaacgacgatgatcatcgcgatggcttcaccaaatggcccttcatgaccacccactcc
tggggcgagtatccacaaggcgtatggaaattggaagcacgcttcaattcggctcaggcg
cgacttggccatctggtggagtggtcgctggtgctgcatggcacgaaggaggccccttat
cgcaccctgaagccatcctcgccgcactcgaagctggccatcgttaagaaggcgcacgaa
gataagaagatgaagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system